Property Summary

Ligand Count 24
NCBI Gene PubMed Count 41
PubMed Score 19.33
PubTator Score 31.69

Knowledge Summary

Patent (777)

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma -1.200 2.0e-02
subependymal giant cell astrocytoma -6.285 3.8e-04

Gene RIF (41)

AA Sequence

MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSFGPV      1 - 70
SDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRNGKKSIAHNMTTPNKLFRIMQ     71 - 140
NGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYPKSEIIYTWKKGPLYSVEVPEESSSLLQYDL    141 - 210
IGQTVSSETIKSNTGEYVIMTVYFHLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTV    211 - 280
LTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTIS    281 - 350
KATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY    351 - 420
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE                                         421 - 453
//

Text Mined References (42)

PMID Year Title