Property Summary

NCBI Gene PubMed Count 41
Grant Count 1
Funding $153,953.43
PubMed Score 17.56
PubTator Score 31.69

Knowledge Summary

Patent (777)

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma -1.200 0.020
subependymal giant cell astrocytoma -6.285 0.000

Synonym

Accession Q16445 A8K096 Q4VAV2
Symbols

Gene

 Grant Application (1)

  TechDev Info (1)

Susumu Tomita Biochemical interactoin

Gene RIF (41)

PMID Text
26535938 NOS3, GABRA6, child abuse, neighborhood crime Gene x Gene, Environment x Environment, and Gene x Environment interactions are associated with different patterns of respiratory sinus arrhythmia reactivity.
25974322 TMEM132D, COMT and GABRA6 gene polymorphisms may influence susceptibility to panic disorder(PD) and major depressive disorder(MDD)in Japanese adults; these variants may increase vulnerability to PD by modulating oligodendrocytes and GABA and dopaminergic functions in related brain regions, altering neuronal processing of anxiety-related emotional signals
25088614 The gene-gene interaction at two loci involving GABRA6 and Synapsin II revealed a significant association for development of idiopathic generalized epilepsy.
23332465 genetic association study in Chinese Han population: Data suggest an SNP in GABRA6 (rs3219151) is associated with decreased predisposition to schizophrenia via alteration of miroRNA binding to target in 3-prime-untranslated region of GABRA6 mRNA.
21930603 GABRA6 mutation, R46W, was identified as a susceptibility gene that may contribute to the pathogenesis of childhood absence epilepsy and cause neuronal disinhibition and increase in seizures via a reduction of alphabetagamma and alphabetadelta receptor function and expression
21902679 Part of the interindividual differences observed for anxiety traits measured by the Harm Avoidance dimension could be explained by the GABRA6 gene variability.
21420396 significant involvement of alpha (GABRA6) and beta (GABRB2) subunits of GABA(A) receptor in epilepsy susceptibility in north Indian population
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20583128 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKTDIYVTSFGPV      1 - 70
SDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRNGKKSIAHNMTTPNKLFRIMQ     71 - 140
NGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYPKSEIIYTWKKGPLYSVEVPEESSSLLQYDL    141 - 210
IGQTVSSETIKSNTGEYVIMTVYFHLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTV    211 - 280
LTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTIS    281 - 350
KATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY    351 - 420
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE                                         421 - 453
//

Text Mined References (42)

PMID Year Title
26535938 2015 A multilevel prediction of physiological response to challenge: Interactions among child maltreatment, neighborhood crime, endothelial nitric oxide synthase gene (eNOS), and GABA(A) receptor subunit alpha-6 gene (GABRA6).
25974322 2015 Association of TMEM132D, COMT, and GABRA6 genotypes with cingulate, frontal cortex and hippocampal emotional processing in panic and major depressive disorder.
25088614 2014 Association of GABRA6 1519 T>C (rs3219151) and Synapsin II (rs37733634) gene polymorphisms with the development of idiopathic generalized epilepsy.
23332465 2013 Polymorphisms in microRNA target sites influence susceptibility to schizophrenia by altering the binding of miRNAs to their targets.
21930603 2011 The GABRA6 mutation, R46W, associated with childhood absence epilepsy, alters 6?22 and 6?2 GABA(A) receptor channel gating and expression.
21902679 2012 The role of genetic variability in the SLC6A4, BDNF and GABRA6 genes in anxiety-related traits.
21420396 2011 Potential role of GABAA receptor subunit; GABRA6, GABRB2 and GABRR2 gene polymorphisms in epilepsy susceptibility and pharmacotherapy in North Indian population.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20583128 2010 Variation at the GABAA receptor gene, Rho 1 (GABRR1) associated with susceptibility to bipolar schizoaffective disorder.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
More...