Property Summary

NCBI Gene PubMed Count 49
PubMed Score 34.38
PubTator Score 8.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute quadriplegic myopathy 1158 6.9e-08
ovarian cancer 8520 1.4e-03
Disease Target Count Z-score Confidence
Obesity 678 3.483 1.7
Sigmoid colon cancer 4 3.077 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy 1.117 6.9e-08
ovarian cancer 1.500 1.4e-03

Gene RIF (25)

AA Sequence

MAAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILER      1 - 70
LLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS     71 - 140
VAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVT    141 - 210
QLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNL    211 - 280
AVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS    281 - 350
KNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTA    351 - 420
IANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPY    421 - 490
YVKPVSTTAVEGAE                                                            491 - 504
//

Text Mined References (55)

PMID Year Title