Property Summary

NCBI Gene PubMed Count 13
PubMed Score 229.21
PubTator Score 32.22

Knowledge Summary

Patent

No data available

Synonym

Accession Q16385 Q16404 Q5JS26 Q96IP7 Q9BU88
Symbols SSX
CT5.2
CT5.2b
HOM-MEL-40

Gene

PANTHER Protein Class (1)

AA Sequence

MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF      1 - 70
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC     71 - 140
PPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
12007189 2002 The cancer-related protein SSX2 interacts with the human homologue of a Ras-like GTPase interactor, RAB3IP, and a novel nuclear protein, SSX2IP.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10749136 2000 Heterogeneous expression of the SSX cancer/testis antigens in human melanoma lesions and cell lines.
More...