Property Summary

NCBI Gene PubMed Count 13
PubMed Score 240.56
PubTator Score 32.22

Knowledge Summary

Patent

No data available

AA Sequence

MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF      1 - 70
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC     71 - 140
PPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (14)

PMID Year Title