Property Summary

NCBI Gene PubMed Count 38
PubMed Score 98.32
PubTator Score 79.09

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q16384 A3KN76 Q08AJ2 Q5JQ64
Symbols SSRC
CT5.1

Gene

PANTHER Protein Class (1)

Gene RIF (17)

PMID Text
25959879 a rare variant of the SS18-SSX1 fusion transcript, which could not be identified by routine procedures for genetic diagnosis, was detected. In addition, 8 missense mutations of cancer-related genes were confirmed
24710929 The mRNA levels of SSX1 and SSX4 are associated with multiple myeloma clinical stage
24166495 SS18-SSX-induced Wnt/beta-catenin signaling appears to be of crucial biological importance in synovial sarcoma tumorigenesis and progression.
24130893 These results suggest that the characteristic speckle localization pattern of SS18-SSX is strongly involved in the tumorigenesis through the SSX moiety of the SS18-SSX fusion protein.
23716114 Knockdown of SS18-SSX1 in synovial sarcoma inhibits viability and induces apoptosis.
23540691 Study shows that the SS18-SSX1 oncogenic fusion usurps SWI/SNF-like BAF complexes, resulting in activation of Sox2, which drives proliferation.
20198325 siRNA targeting of SS18-SSX1 has therapeutic potential for the treatment of synovial sarcoma.
19936258 epigenetic features may define the cellular microenvironment in which SYT-SSX displays its functional effects
19212631 We evaluated the correlations among the expression levels of NY-ESO-1, LAGE-1 and SSX-1 and clinical parameters in hepatocellular carcinoma patients
19204726 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPF      1 - 70
MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLH     71 - 140
PPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (39)

PMID Year Title
25959879 2015 Detection of Rare Variant of SS18-SSX1 Fusion Gene and Mutations of Important Cancer-Related Genes in Synovial Sarcoma of the Lip: Gene Analyses of a Case and Literature Review.
25416956 2014 A proteome-scale map of the human interactome network.
24710929 2014 Expression of cancer-testis antigen in multiple myeloma.
24166495 2014 SS18-SSX fusion protein-induced Wnt/?-catenin signaling is a therapeutic target in synovial sarcoma.
24130893 2013 Truncated SSX protein suppresses synovial sarcoma cell proliferation by inhibiting the localization of SS18-SSX fusion protein.
23716114 2014 Loss of SS18-SSX1 inhibits viability and induces apoptosis in synovial sarcoma.
23701986 A poorly differentiated synovial sarcoma arising from the pulmonary valve.
23691490 2012 Testicular synovial sarcoma: a case report.
23623359 2013 A novel fluorescence in situ hybridization assay for synovial sarcoma.
23540691 2013 Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma.
More...