Property Summary

NCBI Gene PubMed Count 41
PubMed Score 102.77
PubTator Score 79.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Sarcoma, Synovial 5 0.0 0.0
Disease Target Count
Somatic mutation 61
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count
Synovial sarcoma 25

Expression

Gene RIF (20)

AA Sequence

MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPF      1 - 70
MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLH     71 - 140
PPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (42)

PMID Year Title