Property Summary

NCBI Gene PubMed Count 13
PubMed Score 49.41
PubTator Score 15.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.5e-13
Disease Target Count Z-score Confidence
Dry eye syndrome 18 3.824 1.9
Epicondylitis 22 3.682 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 7.5e-13

Gene RIF (4)

AA Sequence

MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ      1 - 70
QRPPKPGGHHRHPPPPPFQNQQRPPRRGHRQLSLPRFPSVSLQEASSFFQRDRPARHPQEQPLW           71 - 134
//

Text Mined References (16)

PMID Year Title