Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.71
PubTator Score 15.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Dry eye syndrome 13 4.113 2.1
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

Gene RIF (4)

PMID Text
26173177 High expression of lacrimal proline-rich protein 4 (PRR4) was found in reflex tears.
24782455 A new PRR4 isoform designated as PRR4-N3 in addition to PRR4 (gi154448886) and pHL E1F1 (gi1050983) was identified in human tear proteome.
23272196 Lacrimal proline rich 4 (LPRR4) protein in the tear fluid is a potential biomarker of dry eye syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ      1 - 70
QRPPKPGGHHRHPPPPPFQNQQRPPRRGHRQLSLPRFPSVSLQEASSFFQRDRPARHPQEQPLW           71 - 134
//

Text Mined References (16)

PMID Year Title
26173177 2015 Characterization of human reflex tear proteome reveals high expression of lacrimal proline-rich protein 4 (PRR4).
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24782455 2014 Characterization of lacrimal proline-rich protein 4 (PRR4) in human tear proteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23272196 2012 Lacrimal proline rich 4 (LPRR4) protein in the tear fluid is a potential biomarker of dry eye syndrome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15526346 2004 Characterization of the in vivo forms of lacrimal-specific proline-rich proteins in human tear fluid.
More...