Property Summary

NCBI Gene PubMed Count 46
PubMed Score 12.92
PubTator Score 42.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung carcinoma 413 4.65065223828198E-14
pilocytic astrocytoma 3086 2.93359917130643E-13
juvenile dermatomyositis 1189 2.24501796337202E-11
ovarian cancer 8492 4.90472995770049E-11
malignant mesothelioma 3163 2.30821694315414E-10
Duchenne muscular dystrophy 602 3.3449796999647E-9
astrocytoma 1493 1.0270682852869E-8
glioblastoma 5572 2.25055974953215E-8
cystic fibrosis 1670 1.78141019081869E-7
pediatric high grade glioma 2712 4.50302259008933E-7
posterior fossa group A ependymoma 1511 5.7166750645459E-7
osteosarcoma 7933 1.21457743352768E-6
lung carcinoma 2844 1.27053144327876E-6
lung adenocarcinoma 2714 5.38753577915142E-6
oligodendroglioma 2849 1.1172803031139E-5
lung cancer 4473 4.85640681771993E-5
breast carcinoma 1614 1.0532060790883E-4
psoriasis 6685 2.30359564350834E-4
invasive ductal carcinoma 2950 3.6754002664882E-4
ductal carcinoma in situ 1745 7.05841275697816E-4
nasopharyngeal carcinoma 1056 9.21266673674329E-4
ulcerative colitis 2087 9.61298608728164E-4
urothelial carcinoma 318 0.00106219037160974
Breast cancer 3099 0.00121666238750072
pancreatic cancer 2300 0.00156864294080357
primary pancreatic ductal adenocarcinoma 1271 0.00162516494211927
subependymal giant cell astrocytoma 2287 0.00259647063512195
interstitial cystitis 2299 0.00284538667853133
Becker muscular dystrophy 187 0.00293249977341912
gastric carcinoma 832 0.00517349063969526
atypical teratoid/rhabdoid tumor 1095 0.00563897164413749
fibroadenoma 557 0.00691711402495953
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0072252873938979
dermatomyositis 967 0.00777794617490096
X-linked cerebral adrenoleukodystrophy 115 0.0201549964206167
head and neck cancer 270 0.0209035034023803
Gaucher disease type 1 171 0.0227223685500364
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0254648749257613
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 51 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0
Disease Target Count
Cardiomyopathy, dilated 1JJ 1

Expression

Synonym

Accession Q16363 Q14731 Q14735 Q15335 Q4LE44 Q5SZG8 Q9BTB8 Q9UE18 Q9UJN9
Symbols LAMA3
CMD1JJ
LAMA4*-1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (25)

PMID Text
26295200 LAMA4-integrin signalling affects chondrocyte morphology and gene expression, contributing to cluster formation in osteoarthritic chondrocytes.
26059342 LAMA4 expression is lowered in preeclamptic placentas and promotes trophoblast cell invasion, migration, and angiogenesis. hypoxia-reoxygenation decreases LAMA4 expression and decouple the relationship between LAMA4 expression and p38 and ERK activation.
25676580 Oxidative stress plays a vital role in controlling expression of LAMA4 through MAPK signaling pathways, which suggests a possible pathological mechanism of pre-eclampsia.
24951930 Laminins 411 and 421 differentially promote tumor cell migration via alpha6beta1 integrin and MCAM (CD146).
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24681327 These results indicate that mAbs to the laminin a4 globular domain are able to inhibit tumor cell adhesion and migration on laminins 411 and 421, and that alpha6beta1 integrin and MCAM bind a4-laminins at very close sites on the globular domain
20485444 Observational study of gene-disease association. (HuGE Navigator)
20433883 Data from experiment with peptide fragments suggest laminin alpha4 (and laminin alpha5) may be part of host defense response and may protect tissues from invading pathogens.
19469865 LAMC2, LAMA4, ITGB1, ITGB3, RSPA and MMP2) are overexpressed in angiotropic melanoma cells vs. non-angiotropic melanoma cells from the same tumor
19048114 LM alpha4 and beta2 have roles in in vitro migration and in vivo tumorigenicity of prostate cancer cells
More...

AA Sequence

MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEKCNAG      1 - 70
FFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGDSIRGAPQFCQPCPCPLPHLA     71 - 140
NFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCR    141 - 210
NCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDL    211 - 280
TDALRLAALSIEEGKSGVLSVSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLL    281 - 350
SDVEELVEKENQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL    351 - 420
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDDYNAKLSDLQE    421 - 490
ALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADSLTTPRLTLSELDDIIKNASG    491 - 560
IYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQEANELSRKLHSSDMNGLVQKALDASNVYENI    561 - 630
VNYVSEANETAEFALNTTDRIYDAVSGIDTQIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGG    631 - 700
ALARKSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFD    701 - 770
SSAYNTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG    771 - 840
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIKNDNLVYVYNL    841 - 910
GTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEFSGDDSLLDLDPEDT    911 - 980
VFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYNFKHIYNMDPSTSVPCARDKLAFTQSRAASY    981 - 1050
FFDGSGYAVVRDITRRGKFGQVTRFDIEVRTPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPV   1051 - 1120
HLEDTLKKAQINDAKYHEISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRA   1121 - 1190
HLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG   1191 - 1260
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVSPTRYELIVDK   1261 - 1330
SRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVDRDVEVEDFQRYTEKVHTSLY   1331 - 1400
ECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWDPVALKLPERNTPRNSHCHLSNSPRAIEHAY   1401 - 1470
QYGGTANSRQEFEHLKGDFGAKSQFSIRLRTRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKL   1471 - 1540
KIRSQEKYNDGLWHDVIFIRERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINS   1541 - 1610
IYSFSGCLSNLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS   1611 - 1680
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLDVDSE   1681 - 1750
VNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGHPVSFSKAALVSGAVSINSC   1751 - 1820
PAA                                                                      1821 - 1823
//

Text Mined References (48)

PMID Year Title
26295200 2016 Effect of Laminin-A4 inhibition on cluster formation of human osteoarthritic chondrocytes.
26059342 2015 Laminin ?4 (LAMA4) expression promotes trophoblast cell invasion, migration, and angiogenesis, and is lowered in preeclamptic placentas.
25676580 2015 The Role of Laminin ?4 in Human Umbilical Vein Endothelial Cells and Pathological Mechanism of Preeclampsia.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24951930 2014 Laminins 411 and 421 differentially promote tumor cell migration via ?6?1 integrin and MCAM (CD146).
24681327 2014 Monoclonal antibodies to human laminin ?4 chain globular domain inhibit tumor cell adhesion and migration on laminins 411 and 421, and binding of ?6?1 integrin and MCAM to ?4-laminins.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20433883 2010 Peptides derived from the human laminin alpha4 and alpha5 chains exhibit antimicrobial activity.
More...