Property Summary

NCBI Gene PubMed Count 50
PubMed Score 14.13
PubTator Score 42.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
CARDIOMYOPATHY, DILATED, 1JJ 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (38)

Disease log2 FC p
adult high grade glioma 1.200 1.3e-03
astrocytoma 1.100 1.0e-08
Astrocytoma, Pilocytic 2.800 2.6e-13
atypical teratoid / rhabdoid tumor 1.200 3.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.370 7.2e-03
Becker muscular dystrophy 1.120 2.9e-03
Breast cancer 1.100 1.2e-03
breast carcinoma -1.800 1.1e-04
cystic fibrosis 4.460 1.8e-07
dermatomyositis 1.900 7.8e-03
Duchenne muscular dystrophy 1.666 3.3e-09
ductal carcinoma in situ -1.600 4.5e-03
ependymoma 1.100 5.2e-03
fibroadenoma -1.900 6.9e-03
gastric carcinoma 1.700 5.2e-03
Gaucher disease type 1 -1.200 2.3e-02
glioblastoma 2.200 2.3e-08
head and neck cancer -1.500 2.1e-02
interstitial cystitis 1.400 2.8e-03
intraductal papillary-mucinous adenoma (... -1.400 2.5e-02
invasive ductal carcinoma -2.400 3.7e-04
juvenile dermatomyositis 1.588 2.2e-11
lung adenocarcinoma -1.100 1.0e-10
lung cancer -2.200 4.9e-04
lung carcinoma -1.200 1.3e-06
malignant mesothelioma -8.700 2.3e-10
nasopharyngeal carcinoma 1.300 9.2e-04
non-small cell lung carcinoma -1.100 4.7e-14
oligodendroglioma 1.100 1.1e-05
osteosarcoma 1.135 2.7e-02
ovarian cancer -5.500 4.9e-11
pancreatic cancer 1.700 1.6e-03
primary pancreatic ductal adenocarcinoma 2.266 1.6e-03
psoriasis -1.200 2.3e-04
subependymal giant cell astrocytoma 1.969 2.6e-03
ulcerative colitis 1.700 9.6e-04
urothelial carcinoma 2.400 1.1e-03
X-linked cerebral adrenoleukodystrophy -1.200 2.0e-02

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEKCNAG      1 - 70
FFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGDSIRGAPQFCQPCPCPLPHLA     71 - 140
NFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCR    141 - 210
NCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDL    211 - 280
TDALRLAALSIEEGKSGVLSVSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLL    281 - 350
SDVEELVEKENQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL    351 - 420
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDDYNAKLSDLQE    421 - 490
ALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADSLTTPRLTLSELDDIIKNASG    491 - 560
IYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQEANELSRKLHSSDMNGLVQKALDASNVYENI    561 - 630
VNYVSEANETAEFALNTTDRIYDAVSGIDTQIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGG    631 - 700
ALARKSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFD    701 - 770
SSAYNTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG    771 - 840
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIKNDNLVYVYNL    841 - 910
GTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEFSGDDSLLDLDPEDT    911 - 980
VFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYNFKHIYNMDPSTSVPCARDKLAFTQSRAASY    981 - 1050
FFDGSGYAVVRDITRRGKFGQVTRFDIEVRTPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPV   1051 - 1120
HLEDTLKKAQINDAKYHEISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRA   1121 - 1190
HLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG   1191 - 1260
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVSPTRYELIVDK   1261 - 1330
SRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVDRDVEVEDFQRYTEKVHTSLY   1331 - 1400
ECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWDPVALKLPERNTPRNSHCHLSNSPRAIEHAY   1401 - 1470
QYGGTANSRQEFEHLKGDFGAKSQFSIRLRTRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKL   1471 - 1540
KIRSQEKYNDGLWHDVIFIRERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINS   1541 - 1610
IYSFSGCLSNLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS   1611 - 1680
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLDVDSE   1681 - 1750
VNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGHPVSFSKAALVSGAVSINSC   1751 - 1820
PAA                                                                      1821 - 1823
//

Text Mined References (52)

PMID Year Title