Property Summary

NCBI Gene PubMed Count 41
PubMed Score 150.14
PubTator Score 81.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma 1.900 4.8e-02
atypical teratoid / rhabdoid tumor -2.100 2.0e-04
Breast cancer -2.500 2.5e-02
cutaneous lupus erythematosus 1.500 3.1e-03
ductal carcinoma in situ 1.500 2.2e-02
glioblastoma -1.300 3.6e-02
group 3 medulloblastoma -2.800 3.0e-05
intraductal papillary-mucinous adenoma (... -1.200 1.5e-03
invasive ductal carcinoma 1.100 2.8e-02
lung adenocarcinoma -1.700 3.7e-10
lung cancer -1.500 2.2e-03
lung carcinoma -2.400 1.5e-26
malignant mesothelioma -1.200 2.7e-04
medulloblastoma, large-cell -2.900 1.5e-03
nasopharyngeal carcinoma -1.600 5.7e-06
non-small cell lung cancer -1.788 2.4e-12
oligodendroglioma 1.200 4.9e-02
osteosarcoma -2.535 3.2e-06
pediatric high grade glioma -1.300 7.2e-03
periodontitis 1.300 8.8e-23
pituitary cancer -1.300 3.3e-03
posterior fossa group A ependymoma 1.200 8.3e-06
primitive neuroectodermal tumor -1.500 3.1e-02
spina bifida -2.052 3.3e-02
tuberculosis 1.600 2.5e-04
urothelial carcinoma -1.400 2.0e-02

Gene RIF (34)

AA Sequence

MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSYYGMKAVLILY      1 - 70
FLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQV     71 - 140
VHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQ    141 - 210
CFGEDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHW    211 - 280
LDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPL    281 - 350
LVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN    351 - 420
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLV    421 - 490
IREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYGVSAYRTVQRGEYPAVH    491 - 560
CRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGL    561 - 630
EFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVK    631 - 700
TEDMRGPADKHIPHIQGNMIKLETKKTKL                                             701 - 729
//

Text Mined References (42)

PMID Year Title