Property Summary

NCBI Gene PubMed Count 40
PubMed Score 145.11
PubTator Score 81.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung carcinoma 2844 1.48597767666917E-26
periodontitis 269 8.76033618722714E-23
non-small cell lung cancer 2798 2.3716285296993E-12
osteosarcoma 7933 1.49715691548604E-10
lung adenocarcinoma 2714 3.68932518721733E-10
posterior fossa group B ependymoma 1530 2.51950283006956E-8
sonic hedgehog group medulloblastoma 1482 2.65809166897326E-7
lung cancer 4473 4.50486869966177E-6
nasopharyngeal carcinoma 1056 5.67353320993181E-6
atypical teratoid/rhabdoid tumor 1095 6.2870112979233E-6
tuberculosis 1563 2.53515626292747E-4
malignant mesothelioma 3163 2.68188430197853E-4
medulloblastoma, large-cell 6234 0.00149508404829851
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00152329360916175
cutaneous lupus erythematosus 1056 0.00309410323983545
pituitary cancer 1972 0.0032852699846029
pediatric high grade glioma 2712 0.00722660541255174
urothelial carcinoma 318 0.0199664442022831
ductal carcinoma in situ 1745 0.0217094659805725
Breast cancer 3099 0.0250450794678322
invasive ductal carcinoma 2950 0.0275995577902393
primitive neuroectodermal tumor 3031 0.0314755639279499
spina bifida 1064 0.0331994072194255
glioblastoma 5572 0.0358365224360094
astrocytic glioma 2241 0.047941346208729
oligodendroglioma 2849 0.0490149630229721
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Expression

  Differential Expression (26)

Synonym

Accession Q16348 A8K1A5 B4E2A7
Symbols PEPT2

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

 GWAS Trait (1)

Gene RIF (33)

PMID Text
26168863 PEPT2 is functionally expressed in H441 cells, making the cell line a good in vitro model to study PEPT2 function and its regulation in human distal lung.
25965825 In vitro study displayed different response to sorafenib depending on the genotype of SLC15A2.
25531100 OSR1 has the capacity to downregulate the peptide transporters PEPT1 and PEPT2 by decreasing the carrier protein abundance in the cell membrane
25514583 This study showed that ALAD2 and hPEPT2*2 may be valuable markers of risk, and indicate novel mechanisms of lead-induced neurotoxicity
23934551 JAK3 is a powerful regulator of the peptide transporters PEPT1 and PEPT2.
22950754 LNCaP expresses high levels of PEPT2 and PHT1.
21366347 PEPT1,PEPT2, PHT1, and PHT2 are expressed in human nasal epithelium.
21327641 ALAD2 and hPEPT2*2 polymorphisms may exaggerate Pb blood burden in boys.
20868728 PepT2-mRNA is expressed in U373-MG and glial cells but showed no regulation of PepT2-mRNA expression in both cell types.
20424473 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSYYGMKAVLILY      1 - 70
FLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQV     71 - 140
VHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQ    141 - 210
CFGEDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHW    211 - 280
LDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPL    281 - 350
LVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN    351 - 420
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLV    421 - 490
IREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYGVSAYRTVQRGEYPAVH    491 - 560
CRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGL    561 - 630
EFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVK    631 - 700
TEDMRGPADKHIPHIQGNMIKLETKKTKL                                             701 - 729
//

Text Mined References (41)

PMID Year Title
26168863 2015 Functional Expression of PEPT2 in the Human Distal Lung Epithelial Cell Line NCl-H441.
25965825 2015 SLC15A2 genomic variation is associated with the extraordinary response of sorafenib treatment: whole-genome analysis in patients with hepatocellular carcinoma.
25531100 2014 Downregulation of peptide transporters PEPT1 and PEPT2 by oxidative stress responsive kinase OSR1.
25514583 ?-Aminolevulinic acid dehydratase single nucleotide polymorphism 2 (ALAD2) and peptide transporter 2*2 haplotype (hPEPT2*2) differently influence neurobehavior in low-level lead exposed children.
23934551 2013 Effect of Janus kinase 3 on the peptide transporters PEPT1 and PEPT2.
22950754 2013 Expression profile and functional activity of peptide transporters in prostate cancer cells.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21366347 2011 Proton-coupled oligopeptide transporter (POT) family expression in human nasal epithelium and their drug transport potential.
21327641 2011 ?-Aminolevulinic acid dehydratase single nucleotide polymorphism 2 and peptide transporter 2*2 haplotype may differentially mediate lead exposure in male children.
20868728 2010 U373-MG cells express PepT2 and accumulate the fluorescently tagged dipeptide-derivative ?-Ala-Lys-N(?)-AMCA.
More...