Property Summary

NCBI Gene PubMed Count 26
PubMed Score 22.05
PubTator Score 160.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Endogenous depression 8
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 1.900 2.9e-04
lung cancer 2.000 1.5e-04
malignant mesothelioma 1.100 7.2e-06
Multiple myeloma 1.480 3.6e-03
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma -2.012 9.8e-05
ovarian cancer -1.100 1.4e-02
tuberculosis 1.100 9.4e-06

Gene RIF (12)

AA Sequence

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPG      1 - 70
RPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGC     71 - 140
LGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKE    141 - 210
DYSEIIGSMGEALEEELDSMAKHESREDKIFQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPD    211 - 280
CPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP          281 - 344
//

Text Mined References (27)

PMID Year Title