Property Summary

NCBI Gene PubMed Count 25
Grant Count 15
R01 Count 6
Funding $1,113,373.59
PubMed Score 21.53
PubTator Score 160.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.480 0.004
malignant mesothelioma 1.100 0.000
osteosarcoma -2.012 0.000
group 3 medulloblastoma 1.900 0.000
tuberculosis 1.100 0.000
lung cancer 2.000 0.000
non primary Sjogren syndrome sicca 1.100 0.015
ovarian cancer -1.400 0.000

Gene RIF (11)

PMID Text
26617804 PDCD2 may play an important role in tumor suppression in osteosarcoma. These mechanisms might be related to immune response induced by CD4(+) and CD8(+) T cells.
25334010 Loss of PDCD2 expression could contribute to gastric cancer development and progression.
25111461 Low PDCD2 expression is associated with gastric cancer.
24381196 Expression of human PDCD2 fully rescues the Drosophila Zfrp8 phenotype, underlining the functional conservation of Zfrp8/PDCD2.
23760497 PDCD2 RNA expression in acute leukemia patients correlates with disease status and is a significant predictor of clinical relapse.
22922207 PDCD2 has a novel regulatory role in human hematopoiesis and is essential for erythroid development.
20605493 Transfection of a construct expressing PDCD2 induces apoptosis in human cell lines through activation of the caspase cascade.
19146857 parkin interacts with programmed cell death-2 isoform 1 (PDCD2-1)
17468402 repression of PDCD2 by BCL6 is likely important in the pathogenesis of certain human lymphomas
16311922 To study the role of PDCD2_C domain in apoptosis, the cDNAs of two isoforms of PDCD2 and MGC13096 were cloned. PDCD2 (NM_002598) was over expressed when endothelial cells treated with leukotriene D4 or natural killer cells were activated by IL-2.
More...

AA Sequence

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPG      1 - 70
RPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGC     71 - 140
LGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKE    141 - 210
DYSEIIGSMGEALEEELDSMAKHESREDKIFQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPD    211 - 280
CPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP          281 - 344
//

Text Mined References (26)

PMID Year Title
26617804 2015 Programmed cell death 2 functions as a tumor suppressor in osteosarcoma.
25334010 2015 Programmed cell death 2 protein induces gastric cancer cell growth arrest at the early S phase of the cell cycle and apoptosis in a p53-dependent manner.
25111461 2014 miR-129-1-3p promote BGC-823 cell proliferation by targeting PDCD2.
24381196 2014 Zfrp8/PDCD2 is required in ovarian stem cells and interacts with the piRNA pathway machinery.
23760497 2013 PDCD2 functions in cancer cell proliferation and predicts relapsed leukemia.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22922207 2012 PDCD2 knockdown inhibits erythroid but not megakaryocytic lineage differentiation of human hematopoietic stem/progenitor cells.
21269460 2011 Initial characterization of the human central proteome.
20605493 2010 PDCD2, a protein whose expression is repressed by BCL6, induces apoptosis in human cells by activation of the caspase cascade.
19958059 2009 Short hairpin RNA targeting beta-catenin suppresses cell proliferation and induces apoptosis in human gastric carcinoma cells.
More...