Property Summary

Ligand Count 3
NCBI Gene PubMed Count 10
PubMed Score 13.32
PubTator Score 8.74

Knowledge Summary

Patent (5,611)

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 1.5e-04
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.9
Disease Target Count Z-score Confidence
Episodic ataxia 22 4.082 2.0
Benign neonatal seizures 4 3.835 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03
psoriasis -1.800 1.5e-04

Gene RIF (3)

AA Sequence

MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHETAFSKLPGDY      1 - 70
ADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQFFDSMRNEYFFDRNRPSFDG     71 - 140
ILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFWLLFEYPE    141 - 210
SSSAARAVAVVSVLVVVISITIFCLETLPEFREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIV    211 - 280
WFTFELVLRFVVCPSKTDFFRNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFR    281 - 350
IFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT    351 - 420
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEIERILNSVGSR    421 - 490
MGSTDSLNKTNGGCSTEKSRK                                                     491 - 511
//

Text Mined References (13)

PMID Year Title