Property Summary

NCBI Gene PubMed Count 120
Grant Count 206
R01 Count 108
Funding $11,209,517.74
PubMed Score 353.23
PubTator Score 230.25

Knowledge Summary

Patent (38,124)

Expression

  Differential Expression (20)

Disease log2 FC p
oligodendroglioma 1.200 0.002
glioblastoma -3.400 0.000
osteosarcoma 1.244 0.001
posterior fossa group B ependymoma -2.600 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -4.600 0.000
colon cancer -1.500 0.000
lung cancer -1.800 0.006
breast carcinoma -1.200 0.000
interstitial cystitis -1.900 0.000
pediatric high grade glioma -2.800 0.000
sonic hedgehog group medulloblastoma 1.700 0.001
Alzheimer's disease 1.200 0.039
Pick disease 1.300 0.001
progressive supranuclear palsy 1.500 0.008
Breast cancer -1.700 0.000
invasive ductal carcinoma -1.200 0.004
ovarian cancer -2.200 0.000
pituitary cancer -1.900 0.000
psoriasis -1.100 0.000

Synonym

Accession Q16288 B7Z4C5 E9PG56 H0YND1 O75682 Q12827 Q16289
Symbols TRKC
GP145-TrkC
gp145(trkC)

Gene

PDB

1WWC   3V5Q   4YMJ  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (86)

PMID Text
26606880 the ETV6-NTRK3 fusion might identify a subset of gastrointestinal stromal tumours with peculiar clinicopathological characteristics
26492182 Molecular analysis of ETV6 gene rearranged mammary analogue secretory carcinoma of salivary glands tumors with lack of classical ETV6-NTRK3 fusion.
26410934 The role of NTRK3 in in paranoid schizophrenia development in Russians.
26291510 Spectrum of secretory breast carcinoma with ETV6-NTRK3 gene fusion ranging from low-grade to high-grade histology, with occasional low hormonal receptor expression, simplex genomic profiles, and possible unfavorable course.
26216473 TNS1, MET, and TRKC tyrosine-phosphorylated proteins are upregulated during epithelial-mesenchymal transition induced with TGF-beta, and predict the outcome in lung adenocarcinoma patients.
26055783 SNPs in the NTRK3 gene, pain, physical activity, and fear of falling were directly associated with depressive symptoms in older adults.
25772499 Experimental verification of a conserved intronic microRNA located in the human TrkC gene with a cell type-dependent apoptotic function.
25456394 Report molecular genetic tests for ETV6-NTRK3 for differential diagnosis of mammary analogue secretory carcinoma of the salivary gland.
25196463 findings suggest a novel pathophysiological mechanism involving NTRK3 in the development of VSDs
24840578 The overall percentage of NTRK3 gene methylation frequency with subsequent loss of mRNA expression was significantly higher in glioma compared with control samples.
More...

AA Sequence

MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS      1 - 70
INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT     71 - 140
TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP    141 - 210
EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF    211 - 280
TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV    281 - 350
EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT    351 - 420
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT    421 - 490
PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL    491 - 560
SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR    561 - 630
AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM    631 - 700
SRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQP    701 - 770
WFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG     771 - 839
//

Text Mined References (123)

PMID Year Title
26606880 2016 Transcriptome sequencing identifies ETV6-NTRK3 as a gene fusion involved in GIST.
26492182 2016 Mammary Analogue Secretory Carcinoma of Salivary Glands: Molecular Analysis of 25 ETV6 Gene Rearranged Tumors With Lack of Detection of Classical ETV6-NTRK3 Fusion Transcript by Standard RT-PCR: Report of 4 Cases Harboring ETV6-X Gene Fusion.
26410934 2015 [The Role of Neurotrophins and Neurexins Genes in the Risk of Paranoid Schizophrenia in Russians and Tatars].
26291510 2015 Secretory Breast Carcinoma: A Histopathologic and Genomic Spectrum Characterized by a Joint Specific ETV6-NTRK3 Gene Fusion.
26216473 2015 Identification of Tyrosine-Phosphorylated Proteins Upregulated during Epithelial-Mesenchymal Transition Induced with TGF-?.
26055783 2015 The Interplay of Genetics, Behavior, and Pain with Depressive Symptoms in the Elderly.
25772499 2015 Experimental verification of a conserved intronic microRNA located in the human TrkC gene with a cell type-dependent apoptotic function.
25456394 2015 Characterization of mammary analogue secretory carcinoma of the salivary gland: discrimination from its mimics by the presence of the ETV6-NTRK3 translocation and novel surrogate markers.
25196463 2014 Mutations in NTRK3 suggest a novel signaling pathway in human congenital heart disease.
24840578 2014 Methylation and expression patterns of tropomyosin-related kinase genes in different grades of glioma.
More...