Property Summary

NCBI Gene PubMed Count 52
PubMed Score 94.78
PubTator Score 75.23

Knowledge Summary

Patent (2,064)

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 2.400 1.5e-03
colon cancer -1.900 2.1e-07
ependymoma 1.400 1.2e-03
glioblastoma 1.500 7.6e-03
medulloblastoma 1.200 2.9e-02
medulloblastoma, large-cell 2.500 6.0e-03
oligodendroglioma 1.900 1.3e-02
pituitary cancer -3.700 5.5e-09
primitive neuroectodermal tumor 1.500 1.5e-02

Gene RIF (39)

AA Sequence

MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGI      1 - 70
ARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCN     71 - 140
TNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSA    141 - 210
DVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLK    211 - 280
FSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSR    281 - 350
KYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSI    351 - 420
KQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGL    421 - 490
LVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKS    491 - 560
GNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKV    561 - 630
EQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ          631 - 694
//

Text Mined References (55)

PMID Year Title