Property Summary

NCBI Gene PubMed Count 11
PubMed Score 59.25
PubTator Score 24.93

Knowledge Summary

Patent (1,725)


  Disease Sources (5)

Disease Target Count
Congenital anosmia 1
Disease Target Count P-value
diabetes mellitus 1663 0.00104821351867176
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count


Accession Q16280 A0AVD0
Symbols CNCA


  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

25156905 Identification of a novel X-linked stop mutation in CNGA2 (c.634C>T, p.R212*) in two brothers with isolated congenital anosmia.
16533895 The results showed that it is predominantly the charge of the E342 residue in the P-loop, rather than the pore helix dipoles, which controls the cation-anion selectivity of the CNGA2 channel.

AA Sequence

QRITVLETKMKQNNEDDYLSDGMNSPELAAADEP                                        631 - 664

Text Mined References (12)

PMID Year Title
25156905 2015 The first mutation in CNGA2 in two brothers with anosmia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16533895 2006 A single P-loop glutamate point mutation to either lysine or arginine switches the cation-anion selectivity of the CNGA2 channel.
16382102 2005 International Union of Pharmacology. LI. Nomenclature and structure-function relationships of cyclic nucleotide-regulated channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14618336 2003 Expression of olfactory-type cyclic nucleotide-gated channel (CNGA2) in vascular tissues.
14604981 2004 Assembly and trafficking of a multiprotein ROMK (Kir 1.1) channel complex by PDZ interactions.
12626507 2003 Calcium/calmodulin modulation of olfactory and rod cyclic nucleotide-gated ion channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9539801 1998 An isoform of the rod photoreceptor cyclic nucleotide-gated channel beta subunit expressed in olfactory neurons.