Property Summary

NCBI Gene PubMed Count 11
PubMed Score 61.20
PubTator Score 24.93

Knowledge Summary

Patent (1,725)

TINX Plot

  Disease (5)

Disease Target Count
Congenital anosmia 1
Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
ENSP00000256078 30 0.0 0.5
Disease Target Count
ANIC 1

Gene RIF (2)

AA Sequence

MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQQGRSGFRRIV      1 - 70
RLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGEDKGTKKKFELFVLDPAGDWY     71 - 140
YCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDYVSDVVYIADLFIRLRTGFLEQGLLVKDTKK    141 - 210
LRDNYIHTLQFKLDVASIIPTDLIYFAVDIHSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVL    211 - 280
YILVIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEY    281 - 350
LFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNK    351 - 420
KTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKE    421 - 490
MYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAV    491 - 560
TEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLK    561 - 630
QRITVLETKMKQNNEDDYLSDGMNSPELAAADEP                                        631 - 664
//

Text Mined References (12)

PMID Year Title