Property Summary

NCBI Gene PubMed Count 83
Grant Count 114
R01 Count 74
Funding $7,969,069.08
PubMed Score 183.73
PubTator Score 128.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.561 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q16254 A6NGR8 B5BU56 Q12991 Q15328 E2F-4
Symbols E2F-4

Gene

PANTHER Protein Class (1)

PDB

1CF7  

Gene RIF (41)

PMID Text
26751588 PHF8 reduces the H3K9me2 level at the E2F4 transcriptional start site, demonstrating a direct function of PHF8 in endothelial E2F4 gene regulation
26369285 cell cycle-dependent transcription of the TRAIP gene by E2F1, E2F2, and E2F4 and rapid protein degradation leads to cell cycle-dependent expression with a maximum in G2/M
25712098 Data suggest that aberrant cell cycle activation in Ewing sarcoma is due to the de-repression of transcription factor E2F targets of transcriptional induction and physical recruitment of E2F3 by fusion protein EWS-FLI1 replacing E2F4 on their promoters.
25650659 Authors show that BRCA1 and RAD17 genes, whose derived proteins play a pivotal role in DNA damage repair, are transcriptional targets of gain-of-function mutant p53 proteins.
24109597 Analysis data from a panel of cell cycle transcription factors (E2F1, E2F4, E2F6, and GABPA) finds that a set of core cell cycle genes regulated in both U2OS and HeLa cells are bound by multiple cell cycle transcription factors.
24100580 cancer-associated E2F4 mutations enhance the capacity of colorectal cancer cells to grow without anchorage, thereby contributing to tumor progression.
24096481 E2F4 promoter occupancy is globally associated with p53-repression targets, but not with p53 activation targets.
23093672 In terminally differentiated cells, common KDM5A and E2F4 gene targets were bound by the pRB-related protein p130, a DREAM complex component.
23060449 Trim28 regulates cell proliferation by bridging HDAC1 and E2F3 and E2F4 interactions.
23015403 Short alleles (<13 repeats) of (AGC)n in E2F4 were less frequent in women with breast cancer than in the control sample.
More...

AA Sequence

MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGL      1 - 70
IEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYV     71 - 140
THEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKEAWSSPPVAVPVP    141 - 210
PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKD    211 - 280
SGELSSLPLGPTTLDTRPLQSSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPK    281 - 350
ELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL           351 - 413
//

Text Mined References (90)

PMID Year Title
26751588 2016 The Histone Demethylase PHF8 Is Essential for Endothelial Cell Migration.
26369285 2015 The TRAF-interacting protein (TRAIP) is a novel E2F target with peak expression in mitosis.
25712098 2015 EWS-FLI1 employs an E2F switch to drive target gene expression.
25650659 2015 Gain of function mutant p53 proteins cooperate with E2F4 to transcriptionally downregulate RAD17 and BRCA1 gene expression.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24109597 2013 Identification of cell cycle-regulated genes periodically expressed in U2OS cells and their regulation by FOXM1 and E2F transcription factors.
24100580 2013 Functional impact of colorectal cancer-associated mutations in the transcription factor E2F4.
24096481 2014 p53-dependent gene repression through p21 is mediated by recruitment of E2F4 repression complexes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...