Property Summary

NCBI Gene PubMed Count 89
PubMed Score 191.71
PubTator Score 128.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 7.8e-10
malignant mesothelioma 3232 2.6e-06
osteosarcoma 7950 2.4e-05
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.476 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 2.6e-06
osteosarcoma -1.561 2.4e-05
ovarian cancer 1.500 7.8e-10

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (45)

AA Sequence

MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGL      1 - 70
IEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYV     71 - 140
THEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQIHLKSVSGPIEVLLVNKEAWSSPPVAVPVP    141 - 210
PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKD    211 - 280
SGELSSLPLGPTTLDTRPLQSSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPK    281 - 350
ELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL           351 - 413
//

Text Mined References (96)

PMID Year Title