Property Summary

NCBI Gene PubMed Count 775
Grant Count 97
R01 Count 46
Funding $7,397,524.87
PubMed Score 1249.18
PubTator Score 1820.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma 1.611 0.000
glioblastoma 1.200 0.013
acute quadriplegic myopathy 1.248 0.000
tuberculosis -1.600 0.000
gastric carcinoma -1.200 0.037
ovarian cancer -2.200 0.000
Down syndrome 1.200 0.002
dermatomyositis 1.200 0.004

Synonym

Gene

PDB

2FLU   2LZ1   3ZGC   4IFL  

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
493153 confirmatory 26 / 247 / 1001 Nrf2 qHTS screen for inhibitors: Validation
493163 summary 0 / 0 / 0 Nrf2 qHTS screen for inhibitors: Summary
504444 confirmatory 7472 / 71105 / 285618 Nrf2 qHTS screen for inhibitors
624149 confirmatory 3 / 27 / 1250 qHTS of Nrf2 Activators: LOPAC Validation
624153 summary 0 / 0 / 0 qHTS of Nrf2 Activators: Summary
624171 confirmatory 1243 / 7974 / 397873 qHTS of Nrf2 Activators
651593 confirmatory 857 / 213 / 36 qHTS of Nrf2 Activators: Hit Validation in Primary Assay
651597 confirmatory 390 / 332 / 384 qHTS of Nrf2 Activators: Hit Validation in Secondary FLuc Assay
720524 confirmatory 1003 / 167 / 189 Nrf2 qHTS screen for inhibitors: Nrf2 A549 ARE-Fluc Confirmation Assay for Hit Validation

Gene RIF (749)

PMID Text
27093399 This shows for the first time that Nrf2 action can potently block HIV infection
27069125 Nrf2 and 8-OHdG influence prognosis in melanoma
27056879 Na2S therapy enhances proteasomal activity and function during the development of heart failure in an Nrf2-dependent manner and that this enhancement leads to attenuation in cardiac dysfunction.
27023064 These data suggest the role of Nrf2, HO-1 and glutathione as molecular targets to improve the efficacy of low doses of bortezomib in the treatment of malignant neuroblastoma.
27020754 Nrf2 binds directly to upstream regions of these pluripotency genes to promote their expression and repress neuroectoderm derivation.Nrf2 suppression was sufficient to rescue poorly neurogenic induced pluripotent stem cell lines.
27012032 Data indicate that miR-153 acts as an oncogene in breast carcinogenesis by targeting NRF2.
26987716 expression of Nrf2-Keap1 is abnormal in osteosarcoma tissue and shows significant clinical relevance for determining the prognosis of osteosarcoma
26942188 cells was consistent with previous studies showing a constitutive expression of their GSTP1. Thus, while both ginger phenylpropanoids and quercetin have the property of increasing the level of Nrf2 both in HaCaT and in BJ cells, their effects on its downstream signalling were mediated only in BJ cells.
26922479 Studies indicate a negative impact of nuclear factor erythroid 2-like factor 2 (Nrf2) signal on non-small cell lung cancer (NSCLC) patients' survival.
26895301 effect of Tat on Nrf2 activation in human neuroblastoma cells and the role of NMDA receptor and spermine oxidase on Tat-induced nuclear factor erythroid 2-related factor 2 (Nrf2) activation
More...

AA Sequence

MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAF      1 - 70
FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATF     71 - 140
QSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVET    141 - 210
TMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTD    211 - 280
FGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNT    281 - 350
SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA    351 - 420
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQF    421 - 490
NEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTL    491 - 560
YLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN                             561 - 605
//

Text Mined References (781)

PMID Year Title
27093399 2016 Sulforaphane Inhibits HIV Infection of Macrophages through Nrf2.
27069125 2016 Nrf2/Keap1 Pathway and Expression of Oxidative Stress Lesions 8-hydroxy-2'-deoxyguanosine and Nitrotyrosine in Melanoma.
27056879 2016 Sodium Sulfide Attenuates Ischemic-Induced Heart Failure by Enhancing Proteasomal Function in an Nrf2-Dependent Manner.
27023064 2016 Role of Nrf2, HO-1 and GSH in Neuroblastoma Cell Resistance to Bortezomib.
27020754 2016 Primary Cilium-Autophagy-Nrf2 (PAN) Axis Activation Commits Human Embryonic Stem Cells to a Neuroectoderm Fate.
27012032 2016 MicroRNA-153 Regulates NRF2 Expression and is Associated with Breast Carcinogenesis.
26987716 2016 Expression of the Nrf2 and Keap1 proteins and their clinical significance in osteosarcoma.
26942188 2016 Effects of Ginger Phenylpropanoids and Quercetin on Nrf2-ARE Pathway in Human BJ Fibroblasts and HaCaT Keratinocytes.
26922479 2016 Emerging roles of Nrf2 signal in non-small cell lung cancer.
26895301 2016 HIV-Tat Induces the Nrf2/ARE Pathway through NMDA Receptor-Elicited Spermine Oxidase Activation in Human Neuroblastoma Cells.
More...