Property Summary

Ligand Count 1
NCBI Gene PubMed Count 946
PubMed Score 1506.69
PubTator Score 1820.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
ovarian cancer 8520 3.0e-09
acute quadriplegic myopathy 1158 3.0e-06
tuberculosis 2010 3.9e-06
osteosarcoma 7950 2.9e-05
psoriasis 6694 6.1e-04
Down syndrome 499 2.3e-03
dermatomyositis 966 3.6e-03
glioblastoma 5792 1.3e-02
gastric carcinoma 807 3.7e-02

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.248 3.0e-06
dermatomyositis 1.200 3.6e-03
Down syndrome 1.200 2.3e-03
gastric carcinoma -1.200 3.7e-02
glioblastoma 1.200 1.3e-02
osteosarcoma 1.275 2.9e-05
ovarian cancer -2.200 3.0e-09
psoriasis 1.400 6.1e-04
tuberculosis -1.100 3.9e-06

Gene RIF (920)

AA Sequence

MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAF      1 - 70
FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATF     71 - 140
QSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVET    141 - 210
TMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTD    211 - 280
FGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNT    281 - 350
SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA    351 - 420
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQF    421 - 490
NEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTL    491 - 560
YLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN                             561 - 605
//

Text Mined References (952)

PMID Year Title