Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.07
PubTator Score 55.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count P-value
tuberculosis 2010 1.2e-05
osteosarcoma 7950 1.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Asbestosis 20 3.056 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.286 1.2e-04
tuberculosis 1.300 1.2e-05

Gene RIF (13)

AA Sequence

MQRDFRWLWVYEIGYAADNSRTLNVDSTAMTLPMSDPTAWATAMNNLGMAPLGIAGQPILPDFDPALGMM      1 - 70
TGIPPITPMMPGLGIVPPPIPPDMPVVKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGT     71 - 140
EQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDD    141 - 210
LYEWECKQRMLAREERHRRRMEEERLRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGE    211 - 280
VNRRSANNFYSMIQSANSHVRRLVNEKAAHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDH    281 - 350
FTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEEMTETKETEESALVSQAEALKEENDS    351 - 420
LRWQLDAYRNEVELLKQEQGKVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELEKLKDDKL    421 - 490
QVEKMLENLKEKESCASRLCASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFLHVHPFGASIEYICSY    491 - 560
LHRLDNKICTSDVECLMGRLQHTFKQEMTGVGASLEKRWKFCGFEGLKLT                        561 - 610
//

Text Mined References (34)

PMID Year Title