Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.42
PubTator Score 55.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
tuberculosis 1,557

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.080 0.000
tuberculosis 1.400 0.000

Synonym

Accession Q16206 A8K197 A8K1C2 Q5VTJ1 Q5VTJ2 Q8WUX0 Q9NTP6 Q9UH82
Symbols APK1
tNOX
COVA1

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
24906676 The findings support a role for arNOX as a major source of oxidative damage leading to cross-linking of skin proteins.
22659163 The results suggest that phosphorylation of serine-504 by PKCdelta modulates the biological function of tNOX.
21625959 this result suggests that hnRNP F directs formation of the exon 4 minus variant of ENOX2.
21571040 increased NADH levels resulting from ENOX2 inhibition result in decreased prosurvival sphingosine-1-phosphate and increased proapoptotic ceramide, both of which may be important to initiation of the ENOX2 inhibitor-induced apoptotic cascade.
20922471 ENOX2 is a dimeric protein containing 4 coppers/dimer capable of carrying out concerted four electron transfers from NADH or ubiquinol to molecular oxygen as required to form water.
20345278 arNOX activity correlates with age and reaches a maximum at about age 65 in males and 55 in females.
19734125 Enhanced arNOX activity correlates with age and with oxidative changes contributing to skin aging.
18789934 These results indicate that tNOX is suppressed during apoptosis and demonstrate that tNOX down-regulation sensitizes cells to stress-induced growth reduction, suggesting that tNOX is required for transformed cell growth.
18351130 A relationship of tNOX to unregulated growth of cancer cells was provided by data where growth of HeLa cells was inhibited by transfection with the exon 5 antisense oligonucleotides
18023414 results indicate that shRNA targeting of tNOX inhibits the growth of cervical cancer cells, and reduces cell migration via a decrease in the membrane association of Rac.
More...

AA Sequence

MQRDFRWLWVYEIGYAADNSRTLNVDSTAMTLPMSDPTAWATAMNNLGMAPLGIAGQPILPDFDPALGMM      1 - 70
TGIPPITPMMPGLGIVPPPIPPDMPVVKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGT     71 - 140
EQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDD    141 - 210
LYEWECKQRMLAREERHRRRMEEERLRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGE    211 - 280
VNRRSANNFYSMIQSANSHVRRLVNEKAAHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDH    281 - 350
FTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEEMTETKETEESALVSQAEALKEENDS    351 - 420
LRWQLDAYRNEVELLKQEQGKVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELEKLKDDKL    421 - 490
QVEKMLENLKEKESCASRLCASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFLHVHPFGASIEYICSY    491 - 560
LHRLDNKICTSDVECLMGRLQHTFKQEMTGVGASLEKRWKFCGFEGLKLT                        561 - 610
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24906676 2014 Age-related NADH oxidase (arNOX)-catalyzed oxidative damage to skin proteins.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22659163 2012 Phosphorylation of serine-504 of tNOX (ENOX2) modulates cell proliferation and migration in cancer cells.
21625959 2011 hnRNP F directs formation of an exon 4 minus variant of tumor-associated NADH oxidase (ENOX2).
21571040 2011 Metabolite modulation of HeLa cell response to ENOX2 inhibitors EGCG and phenoxodiol.
20922471 2010 Essential role of copper in the activity and regular periodicity of a recombinant, tumor-associated, cell surface, growth-related and time-keeping hydroquinone (NADH) oxidase with protein disulfide-thiol interchange activity (ENOX2).
20345278 arNOX: generator of reactive oxygen species in the skin and sera of aging individuals subject to external modulation.
19734125 2008 Age-related ENOX protein (arNOX) activity correlated with oxidative skin damage in the elderly.
18789934 2008 Stress-induced down-regulation of tumor-associated NADH oxidase during apoptosis in transformed cells.
More...