Property Summary

NCBI Gene PubMed Count 45
PubMed Score 72.16
PubTator Score 62.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.260 4.8e-05
aldosterone-producing adenoma -1.321 5.8e-03
atypical teratoid / rhabdoid tumor 1.500 2.5e-03
Breast cancer 2.100 2.8e-02
diabetes mellitus -1.100 4.0e-03
glioblastoma 1.200 2.7e-03
group 3 medulloblastoma -1.100 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-02
malignant mesothelioma -1.800 5.1e-05
ovarian cancer 1.400 4.5e-03
Polycystic ovary syndrome -1.061 3.0e-02
primary pancreatic ductal adenocarcinoma 1.045 2.6e-02
spina bifida -1.637 2.7e-02
tuberculosis and treatment for 6 months 1.200 1.1e-04

Gene RIF (22)

AA Sequence

MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQEN      1 - 70
KVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEF     71 - 140
LTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQ    141 - 210
EALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQ    211 - 280
LQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTV    281 - 350
SSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP    351 - 420
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP                    421 - 474
//

Text Mined References (58)

PMID Year Title