Property Summary

NCBI Gene PubMed Count 43
Grant Count 62
R01 Count 33
Funding $10,071,586.97
PubMed Score 67.36
PubTator Score 62.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16204 Q15250 Q6GSG7
Symbols H4
PTC
TPC
TST1
D10S170

Gene

Gene RIF (20)

PMID Text
25885523 we propose that the amount of CCDC6 protein in primary tumors, as reported in lung, may depend on the impairment of the CCDC6 turnover due to altered protein-protein interaction and post-translational modifications
25751255 Results show that RNA-binding protein EWS binds and regulates CCDC6 expression at RNA and protein levels.
25302833 CCDC6 levels provide valuable insight for OS.
24059746 the loss of CCDC6 could aid the spermatogonial cells to be part of a pro-survival pathway that helps to evade the toxic effects of endogenous oxidants and contributes to testicular neoplastic growth.
23578175 Expression of the CCDC6-RET fusion gene in LC-2/ad cells was demonstrated by the mRNA and protein levels, and the genomic break-point was confirmed by genomic DNA sequencing.
23154560 CCDC6-RET fusion is associated with lung adenocarcinoma.
23145146 CCDC6 is associated with cAMP signaling by fine regulating CREB1 transcriptional activity in normal and transformed thyroid cells.
23108047 It was shown that FBXW7 interacts with and targets CCDC6 for ubiquitin-mediated proteasomal degradation. FBXW7-mediated CCDC6 degradation was impaired in response to DNA damage.
22655027 Following genotoxic stress, loss or inactivation of CCDC6 in cancers that carry the CCDC6 fusion, accelerates the dephosphorylation of pH2AX S139, resulting in defective G2 arrest and premature mitotic entry.
22399611 down-regulation of 14-3-3sigma in the absence of CCDC6 demonstrated their direct association and supports the notion that CCDC6 contributes to cancer development, possibly through malignant pathways involving 14-3-3sigma
More...

AA Sequence

MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQEN      1 - 70
KVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEF     71 - 140
LTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQ    141 - 210
EALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQ    211 - 280
LQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTV    281 - 350
SSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP    351 - 420
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP                    421 - 474
//

Text Mined References (56)

PMID Year Title
25885523 2015 FBXW7 and USP7 regulate CCDC6 turnover during the cell cycle and affect cancer drugs susceptibility in NSCLC.
25751255 2015 The cell cycle regulator CCDC6 is a key target of RNA-binding protein EWS.
25302833 2015 New therapeutic perspectives in CCDC6 deficient lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24059746 2013 Critical role of CCDC6 in the neoplastic growth of testicular germ cell tumors.
23578175 2013 Identification of a lung adenocarcinoma cell line with CCDC6-RET fusion gene and the effect of RET inhibitors in vitro and in vivo.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154560 2012 Identification of CCDC6-RET fusion in the human lung adenocarcinoma cell line, LC-2/ad.
23145146 2012 Identification of sumoylation sites in CCDC6, the first identified RET partner gene in papillary thyroid carcinoma, uncovers a mode of regulating CCDC6 function on CREB1 transcriptional activity.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
More...