Property Summary

NCBI Gene PubMed Count 48
Grant Count 21
R01 Count 18
Funding $3,860,927.64
PubMed Score 41.88
PubTator Score 166.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 0.001
ovarian cancer 2.000 0.000

Gene RIF (28)

PMID Text
26907685 this work implicates hRpn13 and Uch37 in cell cycle progression, providing a rationale for their function in cellular proliferation and for the apoptotic effect of the hRpn13-targeting molecule RA190.
26903513 regulation of NY-ESO-1 processing by the ubiquitin receptors Rpn10 and Rpn13 as a well as by the standard and immunoproteasome is governed by non-canonical ubiquitination on non-lysine sites.
26169395 the binding of SGTA to Rpn13 enables specific polypeptides to escape proteasomal degradation and/or selectively modulates substrate degradation.
25896055 Data suggest that ADRM1 is involved in proliferation of acute leukemia cells; expression of ADRM1 is up-regulated in leukemia; knockdown of ADRM1 inhibits cell proliferation at G0/G1 phase of cell cycle but does not affect apoptosis/cell migration.
25702870 Data show that DEUBAD domain in RPN13 (ADRM1) activates ubiquitin thioesterase L5 (UCH-L5), and the related DEUBAD domain in INO80G (NFRKB) inhibits UCH-L5.
25666615 findings implicate Rpn13 in linking parkin to the 26 S proteasome and regulating the clearance of mitochondrial proteins during mitophagy
24968865 ADRM1 is a candidate target gene in the chromosome 20q13.33 amplicon that may possibly be linked to development of gastric cancer
24910440 Together, our findings suggest that the interaction of Psmd1 with Adrm1 is controlled by SUMOylation in a manner that may alter proteasome composition and function.
24811749 Autoubiquitination of the 26S proteasome on Rpn13 regulates breakdown of ubiquitin conjugates.
24429290 Inherent asymmetry in the 26S proteasome is defined by the ubiquitin receptor RPN13.
More...

AA Sequence

MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE      1 - 70
DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS     71 - 140
GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR    141 - 210
SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP    211 - 280
AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG    281 - 350
QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD                 351 - 407
//

Text Mined References (56)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26907685 2016 The Proteasome Ubiquitin Receptor hRpn13 and Its Interacting Deubiquitinating Enzyme Uch37 Are Required for Proper Cell Cycle Progression.
26903513 2016 Major Histocompatibility Complex (MHC) Class I Processing of the NY-ESO-1 Antigen Is Regulated by Rpn10 and Rpn13 Proteins and Immunoproteasomes following Non-lysine Ubiquitination.
26169395 2015 Binding of SGTA to Rpn13 selectively modulates protein quality control.
25896055 2015 Knockdown of Adhesion-Regulating Molecule 1 Inhibits Proliferation in HL60 Cells.
25702870 2015 Mechanism of UCH-L5 activation and inhibition by DEUBAD domains in RPN13 and INO80G.
25666615 2015 The E3 ubiquitin ligase parkin is recruited to the 26 S proteasome via the proteasomal ubiquitin receptor Rpn13.
25416956 2014 A proteome-scale map of the human interactome network.
24968865 2014 ADRM1 gene amplification is a candidate driver for metastatic gastric cancers.
24910440 2014 SUMOylation of Psmd1 controls Adrm1 interaction with the proteasome.
More...