Property Summary

NCBI Gene PubMed Count 52
PubMed Score 98.48
PubTator Score 19.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.100 5.6e-07
astrocytic glioma -2.400 1.7e-03
Astrocytoma, Pilocytic -3.000 1.1e-11
atypical teratoid / rhabdoid tumor -3.600 1.4e-17
ependymoma -3.000 4.7e-03
glioblastoma -3.000 1.3e-12
group 3 medulloblastoma -2.500 7.4e-05
medulloblastoma, large-cell -2.900 2.8e-07
oligodendroglioma -2.200 2.5e-18
Pick disease -1.600 1.6e-02
pituitary cancer 2.000 2.3e-07
primitive neuroectodermal tumor -3.200 3.7e-07
subependymal giant cell astrocytoma -3.142 4.1e-02

Synonym

Accession Q16143 Q6IAX7
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (34)

AA Sequence

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV      1 - 70
FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA           71 - 134
//

Text Mined References (52)

PMID Year Title