Property Summary

NCBI Gene PubMed Count 50
Grant Count 7
R01 Count 5
Funding $347,730
PubMed Score 89.34
PubTator Score 19.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.400 0.002
ependymoma -3.600 0.000
glioblastoma -3.200 0.000
oligodendroglioma -2.200 0.000
group 4 medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -3.200 0.000
pediatric high grade glioma -3.100 0.000
pilocytic astrocytoma -3.000 0.000
subependymal giant cell astrocytoma -3.142 0.041
Pick disease -1.600 0.016
pituitary cancer 2.000 0.000

Gene RIF (33)

PMID Text
26586132 Cellular pathways affected by bSyn are similar to those affected by aSyn, including impairment of vesicular trafficking and induction of oxidative stress.
26332674 loss of inhibitory C-terminal conformations in disease associated P123H beta-synuclein
26111745 beta-Synuclein expression was locally concentrated and rather modest, but nevertheless changed its effect on amyloid precursor protein expression and plaque load in a time- and concentration-dependent manner.
25389903 The differing aggregation propensities of alpha-synuclein and beta-synuclein are associated with differences in the degree of residual structure in the C-terminus coupled to the shorter separation between the N- and C-termini in beta-synuclein.
23630590 Beta-synuclein protects against isoaspartate accumulation in alpha-synuclein.
23319586 In vivo cross-linking reveals principally oligomeric forms of alpha-synuclein and beta-synuclein in neurons and non-neural cells
23013868 both alphaS- and P123H betaS-globules were formed through similar but distinct pathogenic mechanisms.
22205345 Data provide evidence for the role of beta-synuclein minor transcript variants in the development of complex diseases and provide new insights into the pathogenesis of Lewy body diseases.
21699177 Despite both synucleins sharing considerable sequence homology, the level of carboxy-terminal Src kinase-homologous kinase (CHK) phosphorylation of beta-synuclein is significantly higher than that of alpha-synuclein.
21683963 This study suggested that the pathogenesis of dementia in Parkinson disease, indicating that differential sncb expression in the caudate nucleus may represent one of the molecular mechanisms involved in these complex diseases.
More...

AA Sequence

MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV      1 - 70
FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA           71 - 134
//

Text Mined References (50)

PMID Year Title
26586132 2016 Yeast reveals similar molecular mechanisms underlying alpha- and beta-synuclein toxicity.
26332674 2016 The loss of inhibitory C-terminal conformations in disease associated P123H ?-synuclein.
26111745 2015 Influence of Lentiviral ?-Synuclein Overexpression in the Hippocampus of a Transgenic Mouse Model of Alzheimer's Disease on Amyloid Precursor Protein Metabolism and Pathology.
25389903 2014 A relationship between the transient structure in the monomeric state and the aggregation propensities of ?-synuclein and ?-synuclein.
23630590 2013 Molecular ageing of alpha- and Beta-synucleins: protein damage and repair mechanisms.
23319586 2013 In vivo cross-linking reveals principally oligomeric forms of ?-synuclein and ?-synuclein in neurons and non-neural cells.
23013868 2012 Distinct mechanisms of axonal globule formation in mice expressing human wild type ?-synuclein or dementia with Lewy bodies-linked P123H ?-synuclein.
22205345 2012 New brain-specific beta-synuclein isoforms show expression ratio changes in Lewy body diseases.
21699177 2011 Defining the substrate specificity determinants recognized by the active site of C-terminal Src kinase-homologous kinase (CHK) and identification of ?-synuclein as a potential CHK physiological substrate.
21683963 2011 Alpha- and beta-synuclein expression in Parkinson disease with and without dementia.
More...