Property Summary

NCBI Gene PubMed Count 33
PubMed Score 60.85
PubTator Score 87.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Amino acid metabolic disorder 5 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
active ulcerative colitis -1.026 7.1e-03
adrenocortical carcinoma -1.471 5.6e-04
adult high grade glioma -1.100 1.7e-03
aldosterone-producing adenoma -1.248 1.4e-02
colon cancer -1.200 9.1e-03
ductal carcinoma in situ -1.100 1.6e-03
gastric cancer 1.500 1.6e-04
hepatocellular carcinoma 1.200 1.9e-06
hereditary spastic paraplegia -1.009 8.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.3e-02
invasive ductal carcinoma -1.400 5.3e-03
medulloblastoma, large-cell -1.600 2.7e-06
non-small cell lung cancer -1.011 9.6e-16
osteosarcoma -1.874 1.4e-05
ovarian cancer -1.700 2.5e-09
pancreatic cancer 1.300 3.9e-04
pancreatic carcinoma 1.300 3.9e-04
pancreatic ductal adenocarcinoma liver m... -2.065 6.1e-04
Pick disease -1.100 5.0e-04
progressive supranuclear palsy -1.300 7.2e-03

Synonym

Accession Q16134 B4E3R9 J3KND9 Q7Z347 ETF-QO
Symbols MADD
ETFQO

Gene

PANTHER Protein Class (1)

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGVNMERFAEEAD      1 - 70
VVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNT     71 - 140
PVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHDDGS    141 - 210
VKGIATNDVGIQKDGAPKATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWV    211 - 280
IDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIR    281 - 350
PTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS    351 - 420
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKG    421 - 490
SDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRF    491 - 560
CPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM                 561 - 617
//

Text Mined References (41)

PMID Year Title