Property Summary

Ligand Count 1
NCBI Gene PubMed Count 28
PubMed Score 147.32
PubTator Score 74.43

Knowledge Summary

Patent (7,489)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 1.2e-02
group 3 medulloblastoma 1.600 3.6e-04
oligodendroglioma 1.300 6.8e-03
pituitary cancer 1.200 6.4e-03
psoriasis -1.200 1.5e-19

Gene RIF (20)

AA Sequence

MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFE      1 - 70
LLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLH     71 - 140
PSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDD    141 - 210
KTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQE    211 - 280
FAQSLNQSWQENCDHVPFTGPALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNY    281 - 350
LRMVELEGLTGHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV    351 - 420
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELI    421 - 490
ARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSC    491 - 560
VLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTL    561 - 630
IIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPS    631 - 700
VFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQL    701 - 770
QENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS    771 - 840
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEAA    841 - 910
LVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE                            911 - 956
//

Text Mined References (29)

PMID Year Title