Property Summary

NCBI Gene PubMed Count 27
Grant Count 31
R01 Count 12
Funding $4,299,168.95
PubMed Score 139.27
PubTator Score 74.43

Knowledge Summary

Patent (7,489)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 0.012
oligodendroglioma 1.300 0.007
group 3 medulloblastoma 1.600 0.000
pituitary cancer 1.200 0.006
psoriasis -1.200 0.000

Gene RIF (19)

PMID Text
26139080 Data suggest the involvement of glutamate receptor, ionotropic, kainate 4 protein (GRIK4) in treatment-resistant depression (TRD) and in the risk of developing psychotic symptoms during depressive episodes.
25303296 Subjects possessing the C allele or CC genotype of the GRIK4 polymorphism rs1954787 are more likely to respond to antidepressant treatment.
22052594 The deletion allele affords protection against bipolar disorder through increased KA1 protein abundance in neuronal cells.
21215464 Activation of kainate receptors could serve as a novel mechanism for enhancing B cell activation and immunoglobulin production.
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19924111 The GRIK4 single nucleotide polymorphism (rs12800734) shows a strong association with disease remission in antidepressant treatment.
19924111 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFE      1 - 70
LLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLH     71 - 140
PSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDD    141 - 210
KTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQE    211 - 280
FAQSLNQSWQENCDHVPFTGPALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNY    281 - 350
LRMVELEGLTGHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV    351 - 420
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELI    421 - 490
ARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSC    491 - 560
VLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTL    561 - 630
IIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPS    631 - 700
VFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQL    701 - 770
QENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS    771 - 840
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEAA    841 - 910
LVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE                            911 - 956
//

Text Mined References (28)

PMID Year Title
26139080 2015 The role of GRIK4 gene in treatment-resistant depression.
25303296 2014 GRIK4 polymorphism and its association with antidepressant response in depressed patients: a meta-analysis.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
22052594 2012 GRIK4/KA1 protein expression in human brain and correlation with bipolar disorder risk variant status.
21215464 2011 Glutamate signaling through the kainate receptor enhances human immunoglobulin production.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
More...