Property Summary

NCBI Gene PubMed Count 69
PubMed Score 760.35
PubTator Score 49.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma -2.100 3.9e-05
fibroadenoma -2.100 2.9e-03
inflammatory breast cancer -2.200 3.1e-04
lung adenocarcinoma -1.800 8.5e-11
psoriasis -1.100 4.0e-30

Synonym

Accession Q16082 Q6I9U7 HspB2
Symbols MKBP
HSP27
Hs.78846
LOH11CR1K

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Function (1)

Gene RIF (54)

AA Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS      1 - 70
EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG     71 - 140
ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP                                141 - 182
//

Text Mined References (69)

PMID Year Title