Property Summary

NCBI Gene PubMed Count 68
Grant Count 7
R01 Count 4
Funding $579,591.22
PubMed Score 725.66
PubTator Score 49.37

Knowledge Summary

Patent

No data available

Synonym

Accession Q16082 Q6I9U7 HspB2
Symbols MKBP
HSP27
Hs.78846
LOH11CR1K

Gene

PANTHER Protein Class (1)

Gene RIF (54)

PMID Text
26782567 Three of the differentially expressed heat-schock proteins, HSP90A, HSPB1, and HSPB2, are up-regulated in giant cell tumor of bone patients.
26465331 HspB2 has roles in maintaining ATP levels and as well as chaperone-dependent functions for metabolic homeostasis
24985029 Results suggest a limited function of alphaB-crystallin and HSP27 in preventing abnormal tau protein deposition in glial cells and neurons; in addition, the expression of alphaB-crystallin phosphorylated at Ser59 may act as a protective factor in glial cells.
24859470 These findings provide novel insights into the role of p53 as a regulator of bidirectional gene pair HspB2/alpha B-crystallin-mediated ROS and the Warburg effect
22272249 Study shows that HspB2 oligomers exchange subunits.
21258768 promoter methylation of heat shock protein B2 is a novel molecular biomarker in human esophageal squamous cell carcinoma
20592365 analysis of CEA-, Her2/neu-, BCRP- and Hsp27-positive microparticles in breast cancer patients
20456980 Hsp27, but not the classic Hsp60 and Hsp70, may be associated with the development bronchiolitis obliterans syndrome.
20378664 Observational study of gene-disease association. (HuGE Navigator)
20336542 The abnormal expression of 14-3-3 sigma and HSP27 is significantly associated with lymph node metastasis in colorectal cancer.
More...

AA Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS      1 - 70
EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG     71 - 140
ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP                                141 - 182
//

Text Mined References (68)

PMID Year Title
26782567 2015 Potential role of heat-shock proteins in giant cell tumors.
26465331 2015 Characterization of the Cardiac Overexpression of HSPB2 Reveals Mitochondrial and Myogenic Roles Supported by a Cardiac HspB2 Interactome.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24985029 2014 ?B-crystallin and HSP27 in glial cells in tauopathies.
24859470 2014 As a novel p53 direct target, bidirectional gene HspB2/?B-crystallin regulates the ROS level and Warburg effect.
22272249 2012 HspB2/myotonic dystrophy protein kinase binding protein (MKBP) as a novel molecular chaperone: structural and functional aspects.
21258768 2011 Promoter methylation of heat shock protein B2 in human esophageal squamous cell carcinoma.
20592365 2010 CEA-, Her2/neu-, BCRP- and Hsp27-positive microparticles in breast cancer patients.
20456980 2010 The role of heat shock protein 27 in bronchiolitis obliterans syndrome after lung transplantation.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
More...