Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEECGKAFKQHSTLTTHKIICAE      1 - 70
EKLYRCEECGKAFCQPSTLTRYKRMHRRKKLYKCEECGKAFTQFSTLTKHKRIHTRGKHYKCEESGKAFI     71 - 140
WSSGLTEHRRVHTRQKPYKCEECGKALIQFSTLTRHKRIHTGEKPNKSMWQTF                     141 - 193
//

Text Mined References (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.