Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.44
PubTator Score 8.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.2e-09
tuberculosis 2010 3.5e-06
psoriasis 6694 2.4e-03
Disease Target Count Z-score Confidence
Salmonellosis 42 4.257 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.565 4.2e-09
psoriasis -1.500 2.4e-03
tuberculosis -1.200 3.5e-06

Gene RIF (2)

AA Sequence

MLEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQERWRCLVSTPRDRFKEGIPGK      1 - 70
SRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDS     71 - 140
DHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETHTESFKNSEILKPHRAKPYACNECGKAFSYCSSLSQ    141 - 210
HQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCS    211 - 280
ECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQ    281 - 350
HQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCN    351 - 420
ECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGKAFRCSSAFVR    421 - 490
HQRLHAGE                                                                  491 - 498
//

Text Mined References (13)

PMID Year Title