Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.25
PubTator Score 16.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.896 3.6e-07
atypical teratoid / rhabdoid tumor 1.100 1.0e-05
glioblastoma -1.500 3.0e-04
group 4 medulloblastoma 1.400 4.5e-05
malignant mesothelioma 2.500 3.8e-07
medulloblastoma, large-cell 1.300 3.4e-04
osteosarcoma -3.656 1.3e-09
pediatric high grade glioma -1.100 1.1e-03

Gene RIF (2)

AA Sequence

MELLTFRDVAIEFSPEEWKCLDPDQQNLYRDVMLENYRNLVSLGVAISNPDLVTCLEQRKEPYNVKIHKI      1 - 70
VARPPAMCSHFTQDHWPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSLNECKLQKGGYNEFNECLSTT     71 - 140
QSKILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVIHAGEKPYTCEECGKAFKW    141 - 210
SLIFNEHKRIHTGEKPFTCEECGSIFTTSSHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGE    211 - 280
KPITCEECRKIFTSSSNFAKHKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQ    281 - 350
SSKLNEHKKVHTGERPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIHSAD    351 - 420
KPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT                    421 - 474
//

Text Mined References (8)

PMID Year Title