Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.11
PubTator Score 16.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
POLYDACTYLY, POSTAXIAL, TYPE A6 1
Disease Target Count P-value
osteosarcoma 7933 1.33064314239514E-9
malignant mesothelioma 3163 3.76908549610517E-7
adrenocortical carcinoma 1427 7.54474212605364E-6
atypical teratoid / rhabdoid tumor 4369 9.97802125632672E-6
group 4 medulloblastoma 1875 4.51556076407168E-5
glioblastoma 5572 2.95897833728993E-4
medulloblastoma, large-cell 6234 3.40630585451958E-4
pediatric high grade glioma 2712 0.00111478412714841
Disease Target Count
Postaxial polydactyly type A6 1
Disease Target Count
Polydactyly, postaxial A6 1

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
osteosarcoma -3.656 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma -1.500 0.000
group 4 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.300 0.000
adrenocortical carcinoma -1.929 0.000
pediatric high grade glioma -1.100 0.001

Synonym

Accession Q15928 Q6DK07
Symbols D4S90
PAPA6
pHZ-44

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26515020 To date, at least ten loci and four non-syndromic polydactyly-causing genes, including the GLI3 gene, the ZNF141 gene, the MIPOL1 gene and the PITX1 gene, have been identified. (Review)
23160277 This study revealed involvement of a zinc finger gene ZNF141 in causing autosomal recessive PAP type A, which may open up interesting perspectives into the function of this protein in limb development.

AA Sequence

MELLTFRDVAIEFSPEEWKCLDPDQQNLYRDVMLENYRNLVSLGVAISNPDLVTCLEQRKEPYNVKIHKI      1 - 70
VARPPAMCSHFTQDHWPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSLNECKLQKGGYNEFNECLSTT     71 - 140
QSKILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVIHAGEKPYTCEECGKAFKW    141 - 210
SLIFNEHKRIHTGEKPFTCEECGSIFTTSSHFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGE    211 - 280
KPITCEECRKIFTSSSNFAKHKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQ    281 - 350
SSKLNEHKKVHTGERPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIHSAD    351 - 420
KPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT                    421 - 474
//

Text Mined References (7)

PMID Year Title
26515020 2015 Advances in the molecular genetics of non-syndromic polydactyly.
23160277 2013 Whole exome sequencing identified a novel zinc-finger gene ZNF141 associated with autosomal recessive postaxial polydactyly type A.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9671765 1998 hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer.
8268908 1993 A zinc-finger gene ZNF141 mapping at 4p16.3/D4S90 is a candidate gene for the Wolf-Hirschhorn (4p-) syndrome.