Property Summary

NCBI Gene PubMed Count 5
PubMed Score 16.41
PubTator Score 2.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 8.1e-05
ependymoma 1.200 3.4e-05
group 3 medulloblastoma 1.300 9.5e-03
non primary Sjogren syndrome sicca -1.100 2.5e-02
osteosarcoma 1.133 3.2e-02
primitive neuroectodermal tumor 1.100 6.3e-03

AA Sequence

MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHV      1 - 70
RITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYLQMVHIVEKCTEALSKYLEIDLSMKNNNQHT     71 - 140
DLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPELSTVDI    141 - 210
GFKDNEICILHVESISTAGVENGQFSQPCTSSKASMYFSETQHSLINSTVESRVAEVPGNQDQGLFCENT    211 - 280
EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMG    281 - 350
IRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKR    351 - 420
QSLL                                                                      421 - 424
//

Text Mined References (7)

PMID Year Title