Property Summary

NCBI Gene PubMed Count 34
PubMed Score 290.47
PubTator Score 62.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Craniosynostoses 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Dandy-Walker Syndrome 39 0.0 5.0

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.600 1.2e-03
atypical teratoid / rhabdoid tumor 2.300 2.4e-03
Breast cancer 2.300 4.3e-05
cutaneous lupus erythematosus 2.700 2.3e-02
ependymoma 3.100 4.1e-03
fascioscapulohumeral muscular dystrophy 1.200 1.9e-04
glioblastoma 2.900 3.8e-03
group 3 medulloblastoma 2.500 3.7e-02
lung cancer 5.700 1.8e-07
malignant mesothelioma 7.300 1.4e-09
oligodendroglioma 1.500 6.3e-09
ovarian cancer 1.300 5.0e-02
pediatric high grade glioma 1.400 3.6e-02
Pick disease 2.000 1.4e-03
pituitary cancer -1.100 3.5e-03
psoriasis 1.800 2.0e-19
subependymal giant cell astrocytoma -4.661 7.5e-03

 OMIM Phenotype (1)

Gene RIF (23)

AA Sequence

MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPG      1 - 70
YAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGH     71 - 140
LLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA    141 - 210
GAFFRYMRQPIKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREG    211 - 280
KPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRK    281 - 350
KHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESSTPPTIVSPSTDNPTTS    351 - 420
SLSPSSSAVHHTAGHSALSSNFNEWYV                                               421 - 447
//

Text Mined References (35)

PMID Year Title