Property Summary

NCBI Gene PubMed Count 34
Grant Count 87
R01 Count 65
Funding $8,000,684.26
PubMed Score 277.52
PubTator Score 62.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 7.300 0.000
astrocytic glioma 1.600 0.001
posterior fossa group A ependymoma 3.500 0.000
cutaneous lupus erythematosus 2.700 0.023
glioblastoma 2.900 0.004
oligodendroglioma 1.500 0.000
medulloblastoma 4.900 0.000
atypical teratoid / rhabdoid tumor 2.500 0.012
fascioscapulohumeral muscular dystrophy 1.200 0.000
lung cancer 5.700 0.000
pediatric high grade glioma 1.400 0.036
psoriasis 2.400 0.000
subependymal giant cell astrocytoma -5.592 0.001
Pick disease 2.000 0.001
ovarian cancer 1.300 0.050
Breast cancer 2.300 0.000
pituitary cancer -1.100 0.003

Synonym

Accession Q15915 Q2M3N1
Symbols ZIC
CRS6
ZNF201

Gene

Gene RIF (23)

PMID Text
26670443 down-regulated expression of ZIC1 contributed to the inhibition of cell proliferation, and inhibited the growth of tumor
26340333 Gain-of-Function Mutations in ZIC1 Are Associated with Coronal Craniosynostosis and Learning Disability.
26207911 our results suggest that the Zic1 promoter methylation rate in plasma-derived DNA is of great significance for the early screening of gastric cancer and monitoring of tumorigenesis
25953442 ZIC1 might play a role in the development of Ovarian Cancer, and may be a therapeutic target in OC.
24782033 aberrant methylation is an important mechanism for ZIC1 inactivation in Hepatocellular carcinoma (HCC).
24684457 ZIC1 is frequently inactivated by promoter hypermethyaltion and functions as a tumor suppressor in thyroid cancer through modulating PI3K/Akt and MAPK signaling pathways and transcription factor FOXO3a.
24457242 Loss of ZIC1 expression is associated with malignant pleural mesothelioma.
23937294 Zic transcription factors function in patterning hindbrain motor neurons through their regulation of embryonic retinoic acid signaling
23774800 Methylation of ZIC1, a putative tumor suppressor, may be a novel determinant of ovarian cancer outcome
22799764 Overexpression of ZIC1 results in inactivation of Shh, PI(3)K and MAPK signaling pathways, as well as regulation of multiple downstream targets which are essential for the development and progression of gastric cancer.
More...

AA Sequence

MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPG      1 - 70
YAAAAALGHHHHPGHVGSYSSAAFNSTRDFLFRNRGFGDAAAAASAQHSLFAASAGGFGGPHGHTDAAGH     71 - 140
LLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA    141 - 210
GAFFRYMRQPIKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREG    211 - 280
KPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRK    281 - 350
KHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESSTPPTIVSPSTDNPTTS    351 - 420
SLSPSSSAVHHTAGHSALSSNFNEWYV                                               421 - 447
//

Text Mined References (35)

PMID Year Title
26670443 2015 Clinicopathological significance of increased ZIC1 expression in human endometrial cancer.
26340333 2015 Gain-of-Function Mutations in ZIC1 Are Associated with Coronal Craniosynostosis and Learning Disability.
26207911 2015 Zic1 Promoter Hypermethylation in Plasma DNA Is a Potential Biomarker for Gastric Cancer and Intraepithelial Neoplasia.
25953442 Screening the molecular targets of ovarian cancer based on bioinformatics analysis.
24782033 2014 Role of ZIC1 methylation in hepatocellular carcinoma and its clinical significance.
24684457 2014 ZIC1 is a putative tumor suppressor in thyroid cancer by modulating major signaling pathways and transcription factor FOXO3a.
24457242 2013 ZIC1 is silenced and has tumor suppressor function in malignant pleural mesothelioma.
23937294 2013 The role of Zic transcription factors in regulating hindbrain retinoic acid signaling.
23774800 2013 Comprehensive methylome analysis of ovarian tumors reveals hedgehog signaling pathway regulators as prognostic DNA methylation biomarkers.
22799764 2012 ZIC1 modulates cell-cycle distributions and cell migration through regulation of sonic hedgehog, PI(3)K and MAPK signaling pathways in gastric cancer.
More...