Property Summary

NCBI Gene PubMed Count 564
Grant Count 384
R01 Count 203
Funding $38,244,411.11
PubMed Score 1194.55
PubTator Score 933.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15910 B2RAQ1 B3KS30 B7Z1D6 B7Z7L6 Q15755 Q75MG3 Q92857 Q96FI6
Symbols WVS
ENX1
EZH1
KMT6
WVS2
ENX-1
EZH2b
KMT6A

Gene

PDB

5HYN   5IJ7   5IJ8   2C6V   4MI0   4MI5  

Gene RIF (518)

PMID Text
27113214 EZH2 overexpression is associated aggressive pathologic features including high nuclear grade, high proliferative index, and positivity of HER2 of breast carcinoma.
26970171 Down-regulation of EZH2 expression is associated with myelodysplastic syndromes.
26964089 Uropathogen-induced paracrine factors act epigenetically by altering expression of EZH2, which plays a key role in early host cell proliferative responses to infection.
26897964 EZH2 mediates the regulation of E-cadherin expression by S100A4 and controls the proliferation and migration of gastric cancer cells.
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26871869 JMJD3 and EZH2 in prostate biopsies also demonstrated an increase of JMJD3 and EZH2 in adenocarcinoma with Gleason score 7 and 8 by comparison with a normal biopsy.
26781064 an imbalanced double-negative feedback loop between EZH2 and miR-26a exists in HCC cells, which contributes to miR-26a deregulation and regulates tumor cells proliferation
26766588 Modulation of Polycomb repressive complexes by either Ezh2 overexpression or Eed deletion enhances KRAS-driven adenomagenesis and inflammation
26735435 the expression of metastasis associated 1 family, member 2 and enhancer of zeste 2 polycomb repressive complex 2 subunit correlated negatively with expression of tuberous sclerosis 2
26733151 Data indicate that microRNA miR-26a regulated epithelial-mesenchymal transition (EMT) by targeting enhancer of zeste homolog 2 (EZH2).
More...

AA Sequence

MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI      1 - 70
LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD     71 - 140
QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK    141 - 210
ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS    211 - 280
FHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRP    281 - 350
GGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM    351 - 420
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPR    421 - 490
KKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGC    491 - 560
RCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKD    561 - 630
PVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVM    631 - 700
MVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP                            701 - 746
//

Text Mined References (584)

PMID Year Title
27113214 2016 EZH2 overexpression in different immunophenotypes of breast carcinoma and association with clinicopathologic features.
26970171 2016 Down-regulation of EZH2 expression in myelodysplastic syndromes.
26964089 2016 Uropathogenic E. coli (UPEC) Infection Induces Proliferation through Enhancer of Zeste Homologue 2 (EZH2).
26897964 2015 EZH2 Mediates the Regulation of S100A4 on E-cadherin Expression and the Proliferation, Migration of Gastric Cancer Cells.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26871869 2016 The JMJD3 Histone Demethylase and the EZH2 Histone Methyltransferase in Prostate Cancer.
26781064 2016 A double-negative feedback loop between EZH2 and miR-26a regulates tumor cell growth in hepatocellular carcinoma.
26766588 2016 Polycomb Repressive Complex 2 Is a Barrier to KRAS-Driven Inflammation and Epithelial-Mesenchymal Transition in Non-Small-Cell Lung Cancer.
26735435 2015 Epigenetic regulation of autophagy by the methyltransferase EZH2 through an MTOR-dependent pathway.
26733151 2016 MicroRNA-26a suppresses epithelial-mesenchymal transition in human hepatocellular carcinoma by repressing enhancer of zeste homolog 2.
More...