Property Summary

NCBI Gene PubMed Count 29
PubMed Score 85.42
PubTator Score 307.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 5.86564727635845E-6
invasive ductal carcinoma 2950 4.88182895654541E-4
Pick disease 1893 5.90558604412203E-4
Multiple myeloma 1328 0.0017421935716042
astrocytoma 1493 0.0192685707196646
subependymal giant cell astrocytoma 2287 0.0380757197822716
Disease Target Count Z-score Confidence
Croup 12 3.311 1.7
cystic fibrosis 1670 3.226 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.332 0.002
astrocytoma 1.300 0.019
subependymal giant cell astrocytoma -1.010 0.038
Pick disease -1.100 0.001
invasive ductal carcinoma 1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q15904 A6ZKI4 Q8NBT4 Q9H0C7 V-ATPase subunit S1
Symbols 16A
CF2
Ac45
XAP3
XAP-3
ATP6S1
VATPS1
ATP6IP1

Gene

  Ortholog (10)

Gene RIF (5)

PMID Text
25496667 Genome-wide shRNA screening identifies ATP6AP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of ATP6AP1 by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19246570 Experimental investigation of five specific genes, AP3B1, ATP6AP1, BLOC1S1, LAMP2, and RAB11A, has confirmed novel roles for these proteins in the proper initiation of macroautophagy in amino acid-starved fibroblasts.

AA Sequence

MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPAADTHEGHITS      1 - 70
DLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYA     71 - 140
VSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTL    141 - 210
KSEDVPYTAALTAVRPSRVARDVAVVAGGLGRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKD    211 - 280
QWEDLTPLTFGVQELNLTGSFWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSN    281 - 350
GSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCAS    351 - 420
FFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISLTQIV                        421 - 470
//

Text Mined References (34)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22044156 2012 Novel insights into V-ATPase functioning: distinct roles for its accessory subunits ATP6AP1/Ac45 and ATP6AP2/(pro) renin receptor.
21622230 2011 Functional characterization of (pro)renin receptor in association with V-ATPase.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19246570 2009 Exploring the human genome with functional maps.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...