Property Summary

Ligand Count 1
NCBI Gene PubMed Count 31
PubMed Score 91.28
PubTator Score 307.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.300 1.9e-02
invasive ductal carcinoma 1.100 4.9e-04
Multiple myeloma 1.332 1.7e-03
ovarian cancer 1.800 5.9e-06
Pick disease -1.100 5.9e-04
subependymal giant cell astrocytoma -1.010 3.8e-02

 OMIM Phenotype (1)

Gene RIF (6)

AA Sequence

MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLWSSDRDLWAPAADTHEGHITS      1 - 70
DLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYA     71 - 140
VSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTL    141 - 210
KSEDVPYTAALTAVRPSRVARDVAVVAGGLGRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKD    211 - 280
QWEDLTPLTFGVQELNLTGSFWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSN    281 - 350
GSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQIQAFNVMGEQFSYASDCAS    351 - 420
FFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTISLTQIV                        421 - 470
//

Text Mined References (37)

PMID Year Title