Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.20
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 5.2e-03
Breast cancer -3.200 1.6e-19
breast carcinoma -1.600 1.2e-03
cutaneous lupus erythematosus -1.500 1.1e-02
group 3 medulloblastoma -2.000 2.2e-03
invasive ductal carcinoma -1.500 3.1e-02
lung adenocarcinoma -1.900 1.6e-14
lung cancer -2.900 2.5e-06
lung carcinoma -2.600 6.5e-30
medulloblastoma, large-cell -1.800 3.9e-04
non-small cell lung cancer -3.225 1.3e-35
oligodendroglioma 1.400 8.4e-03
pituitary cancer -1.200 2.7e-03
posterior fossa group A ependymoma 1.400 3.8e-06
primary Sjogren syndrome -1.400 6.9e-04
primitive neuroectodermal tumor -1.200 1.1e-02
psoriasis -1.800 2.9e-10

AA Sequence

MILLVNLFVLLSVVCVLLNLAGFILGCQGAQFVSSVPRCDLVDLGEGKICFCCEEFQPAKCTDKENALKL      1 - 70
FPVQPCSAVHLLLKKVLFALCALNALTTTVCLVAAALRYLQIFATRRSCIDESQISAEEAEDHGRIPDPD     71 - 140
DFVPPVPPPSYFATFYSCTPRMNRRMVGPDVIPLPHIYGARIKGVEVFCPLDPPPPYEAVVSQMDQEQGS    141 - 210
SFQMSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLH    211 - 280
PSEERAAPVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMT    281 - 350
PDIHELVENIKSVLKSDEEHMEEAITSASFLEQIMAPLQPSTSRAHKLPSRRQPGLLHLQSCGDLHTFTP    351 - 420
AGRPRAERRPRRVEAERPHSLIGVIRETVL                                            421 - 450
//

Text Mined References (9)

PMID Year Title