Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.20
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.27811468205694E-35
lung carcinoma 2844 6.45286765799405E-30
lung adenocarcinoma 2714 7.72896626902202E-18
psoriasis 6685 2.88569568919461E-10
posterior fossa group B ependymoma 1530 1.57236951270653E-7
non-inflammatory breast cancer 208 1.79848786822733E-6
lung cancer 4473 2.497211883605E-6
sonic hedgehog group medulloblastoma 1482 2.37003408568346E-5
medulloblastoma, large-cell 6234 3.86412625844169E-4
primary Sjogren syndrome 789 6.92299727239776E-4
breast carcinoma 1614 0.0011621634494706
pituitary cancer 1972 0.00271991052052878
oligodendroglioma 2849 0.0084058580434214
pilocytic astrocytoma 3086 0.0108526302210837
cutaneous lupus erythematosus 1056 0.0108720922137609
primitive neuroectodermal tumor 3031 0.0112159076076407
invasive ductal carcinoma 2950 0.0305231518916229
Disease Target Count Z-score Confidence
Gonadal dysgenesis 6 3.503 1.8

Expression

  Differential Expression (17)

Synonym

Accession Q15884 Q14CN5 Q5T6C8 Q5T6C9 Q6ZTX4 Q96N10
Symbols X123
C9orf61

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MILLVNLFVLLSVVCVLLNLAGFILGCQGAQFVSSVPRCDLVDLGEGKICFCCEEFQPAKCTDKENALKL      1 - 70
FPVQPCSAVHLLLKKVLFALCALNALTTTVCLVAAALRYLQIFATRRSCIDESQISAEEAEDHGRIPDPD     71 - 140
DFVPPVPPPSYFATFYSCTPRMNRRMVGPDVIPLPHIYGARIKGVEVFCPLDPPPPYEAVVSQMDQEQGS    141 - 210
SFQMSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLH    211 - 280
PSEERAAPVLSCEAATQTERRLDLAAVTLRRGLRSRASRCRPRSLIDYKSYMDTKLLVARFLEQSSCTMT    281 - 350
PDIHELVENIKSVLKSDEEHMEEAITSASFLEQIMAPLQPSTSRAHKLPSRRQPGLLHLQSCGDLHTFTP    351 - 420
AGRPRAERRPRRVEAERPHSLIGVIRETVL                                            421 - 450
//

Text Mined References (9)

PMID Year Title
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7951235 1994 The Friedreich ataxia region: characterization of two novel genes and reduction of the critical region to 300 kb.