Property Summary

NCBI Gene PubMed Count 64
Grant Count 130
R01 Count 87
Funding $18,168,560.77
PubMed Score 340.30
PubTator Score 175.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Peritonitis 37 4.255 2.1

Expression

Synonym

Accession Q15853 O00671 O00709 Q05750 Q07952 Q15851 Q15852 Q6FI33 Q6YI47
Symbols FIP
bHLHb12

Gene

Gene RIF (37)

PMID Text
25149140 Increased upstream stimulatory factor in HCC is associated with heparanase expression. USF might be an important factor in regulating HPSE expression and act as a novel marker of metastatic recurrence of HCC patients
24905330 USF2, and its target gene PAI-1, regulate serum-stimulated keratinocyte growth, and likely the cadence of cell cycle progression in replicatively competent cells as part of the injury repair program.
23991099 RNA Pol II on HIF1 or HIF2 target genes is primarily associated with HIF1alpha or HIF2alpha in a STAT3 or USF2 dependent manner
23560079 USF2 functionally interacts with YY1 blocking its inhibitory activity, in favor of CEBPB transactivation.
22966206 USF2 and hypoxia-inducible factor 2alpha (HIF2alpha) cooperatively activate HIF2 target genes during hypoxia.
22891280 Transcription factors upstream stimulatory factor 1 (USF-1) and USF-2 are indispensable for the transcription of RORgammaT in human lymphocytes.
21921026 Bone morphogenetic proteins and ID1 exerted an anti-apoptotic effect in mesangial cells by inhibition of USF2 transcriptional activity.
21813151 These data indicate that an E-box motif (RBE1) within the core promoter in the long terminal repeat of HIV-1 is a bona fide binding site for the RBF-2 transcription factor complex USF1, USF2, and TFII-I.
20814220 data established that high glucose stimulated USF2 expression in HK-2 cells, at least in part, through angiotensin II-AT1-dependent activation of CREB, which can contribute to diabetic tubulointerstitial fibrosis
20626032 Usf2 mediates quercetin-induced suppression of PAI-1 gene expression in human endothelial cells
More...

AA Sequence

MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRT      1 - 70
ETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAP     71 - 140
FPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGT    141 - 210
QRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGIL    211 - 280
SKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ        281 - 346
//

Text Mined References (64)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25149140 2014 Expressions of heparanase and upstream stimulatory factor in hepatocellular carcinoma.
24905330 2014 The basic helix-loop-helix/leucine zipper transcription factor USF2 integrates serum-induced PAI-1 expression and keratinocyte growth.
23991099 2013 STAT3 or USF2 contributes to HIF target gene specificity.
23560079 2013 Phosphorylated C/EBP? influences a complex network involving YY1 and USF2 in lung epithelial cells.
22966206 2012 Upstream stimulatory factor 2 and hypoxia-inducible factor 2? (HIF2?) cooperatively activate HIF2 target genes during hypoxia.
22891280 2012 Upstream stimulating factors regulate the expression of ROR?T in human lymphocytes.
21921026 2011 ID1 inhibits USF2 and blocks TGF-?-induced apoptosis in mesangial cells.
21813151 2011 Identification and functional analysis of a second RBF-2 binding site within the HIV-1 promoter.
20814220 2011 High glucose upregulates upstream stimulatory factor 2 in human renal proximal tubular cells through angiotensin II-dependent activation of CREB.
More...