Property Summary

NCBI Gene PubMed Count 28
Grant Count 54
R01 Count 39
Funding $10,262,377.07
PubMed Score 138.40
PubTator Score 87.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
ovarian cancer 1.300 0.000

Gene RIF (14)

PMID Text
26927669 UT2 is a negative regulator shared across STAT3 and mTORC2 signaling cascades, functioning as a tumor suppressor in hematologic malignancies driven by those pathways.
25298341 Studies indicate that the cell signaling pathway for vasopressin-mediated urea transporters phosphorylation and activity involves two cAMP-dependent signaling pathways.
25298340 Studies indicate that osmotic diuresis, where urea concentrations are low, can prompt an increase in urea transporter abundance.
25298338 Studies indicate that the urea transporter SLC14a2, the UT-A group, was originally isolated from kidney inner medulla.
20797394 HUT2 gene may play a certain role in developing metabolic syndrome and its related traits in Asian population.
20797394 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17344938 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17344938 polymorphisms in the SLC14A2 gene can predict the antihypertensive efficacy of nifedipine GITS (gastrointestinal therapeutic system)
More...

AA Sequence

MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSHIVKIEKLNER      1 - 70
SKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQVMFINNPLSGLI     71 - 140
IFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASGLHGYNGMLVGLLMAVFSEKLDYYWWLLFPV    141 - 210
TFTAMSCPVLSSALNSIFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMP    211 - 280
LLLQAIPVGVGQVYGCDNPWTGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNC    281 - 350
VLSCIAIGGMFYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF    351 - 420
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRS    421 - 490
KVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYI    491 - 560
TGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQNPWWAISGCLGTIMSTLTAL    561 - 630
ILSQDKSAIAAGFHGYNGVLVGLLMAVFSDKGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTL    631 - 700
PFNITVTLYLAATGHYNLFFPTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIA    701 - 770
LFISSPLICLHAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF    771 - 840
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYLSQERNRRASI    841 - 910
ITKYQAYDVS                                                                911 - 920
//

Text Mined References (31)

PMID Year Title
26927669 2016 Endogenous transmembrane protein UT2 inhibits pSTAT3 and suppresses hematological malignancy.
25298341 2014 Biochemical properties of urea transporters.
25298340 2014 Expression of urea transporters and their regulation.
25298338 2014 Genes and proteins of urea transporters.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22693459 2012 Six novel susceptibility Loci for early-onset androgenetic alopecia and their unexpected association with common diseases.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
More...