Property Summary

NCBI Gene PubMed Count 1,952
PubMed Score 7629.18
PubTator Score 6859.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Disease of metabolism 18 0.0 3.0
Type 2 diabetes mellitus 272 0.0 1.1

Expression

 IMPC Phenotype (1)

Gene RIF (2049)

AA Sequence

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGD      1 - 70
PGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQ     71 - 140
NHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ    141 - 210
VWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN                                        211 - 244
//

Text Mined References (1955)

PMID Year Title