Property Summary

NCBI Gene PubMed Count 1,813
PubMed Score 7127.04
PubTator Score 6859.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
acute quadriplegic myopathy 1157 7.15275356174523E-7
adrenocortical carcinoma 1427 1.67574041231272E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.16209016533781E-4
psoriasis 6685 4.29508543882098E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.74332222479088E-4
breast carcinoma 1614 0.00135790283644876
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0014518677454065
invasive ductal carcinoma 2950 0.00358422426138407
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00636271757747442
Duchenne muscular dystrophy 602 0.0140561544724755
Atopic dermatitis 944 0.0142881000563772
colon cancer 1475 0.0144215338520598
fibroadenoma 557 0.0150928435778596
adrenocortical adenoma 134 0.0184269381683035
ductal carcinoma in situ 1745 0.0273063926399864
aldosterone-producing adenoma 664 0.028752324338651
dermatomyositis 967 0.0303403544914835
fascioscapulohumeral muscular dystrophy 100 0.0308315505915707
limb girdle muscular dystrophy 2I 56 0.0350784520620247
Disease Target Count Z-score Confidence
Disease of metabolism 15 0.0 2.0
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Obesity 616 7.776 3.9
diabetes mellitus 1663 7.111 3.6
Disease Target Count
Adiponectin deficiency 1

Expression

Synonym

Accession Q15848 Q58EX9
Symbols ACDC
ADPN
APM1
APM-1
GBP28
ACRP30
ADIPQTL1

Gene

PDB

4DOU  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1914)

PMID Text
27012030 No association between leptin, adiponectin, and weight loss in chronic kidney disease stage-5 patients.
26909902 No association between adiponectin gene T45G polymorphism and nonalcoholic fatty liver disease was established.
26871804 The levels of adiponectin in the mild- and moderate-type hemorrhagic fever with renal syndrome patients in the acute stage were higher than the severe-type and control and decreased with severity of the disease.
26853401 Obese leukemic survivors had lower serum adiponectin levels than nonobese survivors
26838789 Adiponectin directly decreases myocardial redox state via paracrine/endocrine effects.
26817832 Suggest that the paradoxical association between high serum adiponectin levels and increased cardiovascular mortality rate is based on a cause-effect relationship in type 2 diabetics.
26808583 subgroup analysis showed that serum adiponectin levels in T2DM patients increased after the treatment of metformin
26797284 Accordingly, we propose that the anti-fibrotic activity of adiponectin may be mediated through AdipoR1/R2 receptors.
26773775 Data suggest that overweight interacts with vitamin D deficiency to modulate inflammatory response, affecting plasma levels of adiponectin, sICAM1 (soluble intercellular adhesion molecule-1), and cytokines (interleukin 6, tumor necrosis factor-alpha).
26754433 Variations in AdipoQ gene can protect against Coronary Heart Disease.
More...

AA Sequence

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGD      1 - 70
PGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQ     71 - 140
NHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ    141 - 210
VWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN                                        211 - 244
//

Text Mined References (1816)

PMID Year Title
27012030 2016 Adipocytokines in Patients with Chronic Kidney Disease Stage 5.
26909902 2016 Association between adiponectin gene T45G polymorphism and nonalcoholic fatty liver disease risk: a meta-analysis.
26871804 2016 Changes in Plasma Adiponectin Concentrations in Patients With Hemorrhagic Fever With Renal Syndrome: An Observational Prospective Study.
26853401 Adiponectin correlates with obesity: A study of 159 childhood acute leukemia survivors from India.
26838789 2016 Mutual Regulation of Epicardial Adipose Tissue and Myocardial Redox State by PPAR-?/Adiponectin Signalling.
26817832 2016 Evidence of a causal relationship between high serum adiponectin levels and increased cardiovascular mortality rate in patients with type 2 diabetes.
26808583 2016 Relationship of Serum Adiponectin Levels and Metformin Therapy in Patients with Type 2 Diabetes.
26797284 2016 Adiponectin inhibits Wnt co-receptor, Lrp6, phosphorylation and ?-catenin signaling.
26773775 2016 Association between 25-hydroxyvitamin D and inflammatory biomarker levels in a cross-sectional population-based study, São Paulo, Brazil.
26754433 2016 Single nucleotide polymorphism rs3774261 in the AdipoQ gene is associated with the risk of coronary heart disease (CHD) in Northeast Han Chinese population: a case-control study.
More...