Property Summary

NCBI Gene PubMed Count 11
Grant Count 186
R01 Count 64
Funding $46,166,973.13
PubMed Score 1824.52
PubTator Score 37.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (51)

Disease Z-score Confidence
diabetes mellitus 1,663 4.046 2.0
Hypertension 287 3.996 2.0
Schizophrenia 501 3.747 1.9
Lupus erythematosus 80 3.701 1.9
Malaria 140 3.637 1.8
Neuromyelitis optica 20 3.413 1.7
Acquired immunodeficiency syndrome 164 3.268 1.6
Connective tissue disease 59 3.231 1.6
Sickle cell anemia 35 3.231 1.6
Coronary artery disease 240 3.179 1.6
Tropical spastic paraparesis 17 3.165 1.6
sarcoidosis 358 3.156 1.6
INFANTILE CEREBELLAR-RETINAL DEGENERATIO... 3  3.106 1.6
Cerebrovascular disease 231 3.097 1.5
Obesity 616 3.093 1.5
Skin disease 65 3.028 1.5
Cancer 2,346 3.005 1.5
Becker muscular dystrophy 187
Duchenne muscular dystrophy 602
active Crohn's disease 918
acute quadriplegic myopathy 1,157
adrenocortical adenoma 134
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
ductal carcinoma in situ 1,745
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685
ulcerative colitis 2,087

Expression

Synonym

Accession Q15847
Symbols AFRO
APM2
apM-2
C10orf116

Gene

Gene RIF (3)

PMID Text
23239344 Over-expressed in omental tissues from obese patients, C10orf16 manifested the characteristics of an adipocyte lineage-specific nuclear factor that can modulate the master adipogenesis transcription factors early during differentiation.
19444912 Overexpression of APM2 promote cisplatin resistance in cancer.
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGK      1 - 70
KFGLLK                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23467766 2013 Overexpression of C10orf116 promotes proliferation, inhibits apoptosis and enhances glucose transport in 3T3-L1 adipocytes.
23239344 2013 A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPAR? and C/EBP?.
21269460 2011 Initial characterization of the human central proteome.
19444912 2009 APM2 is a novel mediator of cisplatin resistance in a variety of cancer cell types regardless of p53 or MMR status.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
More...