Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1824.52
PubTator Score 37.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.97025798467895E-24
lung carcinoma 2844 2.23394278805625E-15
lung adenocarcinoma 2714 3.02850565351986E-13
breast carcinoma 1614 5.44875466466102E-10
atypical teratoid / rhabdoid tumor 4369 1.18119112137447E-8
Duchenne muscular dystrophy 602 1.92234496558843E-8
oligodendroglioma 2849 5.30804589911382E-8
limb girdle muscular dystrophy 2A 156 5.70578210462053E-8
ovarian cancer 8492 1.21280194533837E-7
medulloblastoma 1524 5.08913533078315E-7
malignant mesothelioma 3163 5.21249252987277E-7
acute quadriplegic myopathy 1157 5.5882058391E-7
lung cancer 4473 7.1677495020787E-7
ulcerative colitis 2087 1.18293317442349E-6
medulloblastoma, large-cell 6234 2.00721187995631E-6
adrenocortical carcinoma 1427 7.07790092359792E-5
interstitial cystitis 2299 1.06780305983196E-4
psoriasis 6685 1.72724572233777E-4
glioblastoma 5572 2.08221350402883E-4
Becker muscular dystrophy 187 2.09683349836269E-4
adult high grade glioma 2148 4.60029532284447E-4
pituitary cancer 1972 7.23242329972119E-4
ductal carcinoma in situ 1745 0.00135903787357436
nasopharyngeal carcinoma 1056 0.00162032665583891
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00212102911925096
invasive ductal carcinoma 2950 0.00270366703027481
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00552084539442095
primitive neuroectodermal tumor 3031 0.00746476319167031
active Crohn's disease 918 0.00958781035705788
adrenocortical adenoma 134 0.0110869039586589
esophageal adenocarcinoma 737 0.0215985203137089
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.022705024337716
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0301358769891178
ependymoma 2514 0.047531449386126

Expression

Synonym

Accession Q15847
Symbols AFRO
APM2
apM-2
C10orf116

Gene

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Cow OMA EggNOG

Gene RIF (3)

PMID Text
23239344 Over-expressed in omental tissues from obese patients, C10orf16 manifested the characteristics of an adipocyte lineage-specific nuclear factor that can modulate the master adipogenesis transcription factors early during differentiation.
19444912 Overexpression of APM2 promote cisplatin resistance in cancer.
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGK      1 - 70
KFGLLK                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23467766 2013 Overexpression of C10orf116 promotes proliferation, inhibits apoptosis and enhances glucose transport in 3T3-L1 adipocytes.
23239344 2013 A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPAR? and C/EBP?.
21269460 2011 Initial characterization of the human central proteome.
19444912 2009 APM2 is a novel mediator of cisplatin resistance in a variety of cancer cell types regardless of p53 or MMR status.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
More...