Property Summary

NCBI Gene PubMed Count 11
PubMed Score 160.46
PubTator Score 37.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (34)

Disease log2 FC p
active Crohn's disease -2.396 9.6e-03
active ulcerative colitis -2.000 1.6e-02
acute quadriplegic myopathy 1.925 5.6e-07
adrenocortical adenoma -1.249 1.1e-02
adrenocortical carcinoma -1.669 7.1e-05
adult high grade glioma -2.100 4.6e-04
atypical teratoid / rhabdoid tumor -3.000 1.2e-08
autosomal dominant Emery-Dreifuss muscul... 1.344 5.5e-03
Becker muscular dystrophy 1.205 2.1e-04
breast carcinoma -1.600 5.4e-10
Duchenne muscular dystrophy 1.572 1.9e-08
ductal carcinoma in situ -2.500 1.4e-03
ependymoma -2.200 4.8e-02
esophageal adenocarcinoma -2.000 2.2e-02
glioblastoma -1.300 9.3e-03
group 3 medulloblastoma -1.200 3.8e-02
interstitial cystitis -1.900 1.2e-03
intraductal papillary-mucinous adenoma (... -1.800 2.1e-03
intraductal papillary-mucinous carcinoma... -1.400 3.0e-02
intraductal papillary-mucinous neoplasm ... -1.900 2.3e-02
invasive ductal carcinoma -1.406 1.4e-02
limb girdle muscular dystrophy 2A 1.700 5.7e-08
lung adenocarcinoma -1.400 1.8e-18
lung cancer -2.200 1.0e-04
lung carcinoma -1.200 2.2e-15
malignant mesothelioma -3.400 5.2e-07
medulloblastoma, large-cell -3.100 2.0e-06
nasopharyngeal carcinoma -1.400 1.6e-03
non-small cell lung cancer -3.263 4.0e-24
oligodendroglioma -1.200 5.3e-08
ovarian cancer -2.700 1.2e-07
pituitary cancer -1.500 7.2e-04
primitive neuroectodermal tumor -2.200 7.5e-03
psoriasis -1.300 7.7e-08

Synonym

Accession Q15847
Symbols AFRO
APM2
apM-2
C10orf116

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGK      1 - 70
KFGLLK                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title