Property Summary

NCBI Gene PubMed Count 118
PubMed Score 229.96
PubTator Score 196.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2388 3.637 1.8

Expression

Protein-protein Interaction (7)

Gene RIF (85)

AA Sequence

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV      1 - 70
LALRGGGGLRQ                                                                71 - 81
//

Text Mined References (118)

PMID Year Title