Property Summary

NCBI Gene PubMed Count 110
Grant Count 158
R01 Count 119
Funding $16,861,281
PubMed Score 210.42
PubTator Score 196.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.532 1.8

Expression

Synonym

Accession Q15843 Q3SXN8 Q6LES6
Symbols NEDD-8

Gene

PDB

4P5O   1R4M   1R4N   2NVU   3DBH   3DBL   3DBR   3GZN   3DQV   1NDD   1XT9   2BKR   2KO3   4F8C   4FBJ   4HCP  

Gene RIF (78)

PMID Text
26632597 Nedd8(Q40E) cannot induce the same structural effect on Cul1-Rbx1 as wild-type Nedd8.
26003431 findings add novel evidence showing, for what we believe the first time, that NEDD8-mediated neddylation is required for normal human endometrial functions
25981045 HIV-1 complexes with NEDD8
25918018 This work sheds new light on the roles of NEDD8 lysines on neddylation cascades and provides a dominant negative mutant for the study of neddylation and its biological functions.
25782162 we report that MLN4924 (NEDD8 enzyme inhibitor ) specifically inhibited protein neddylation, inactivated cullin-RING E3 ligase (CRL), the best-known neddylation substrate, and induced the accumulation CRL substrates in lymphoma cells.
25655932 In endothelial dysfunction, HDAC2 levels were reciprocally regulated by ectopic expression of NEDD8 and the de-NEDDylating enzyme SENP8.
25452302 a role of Nedd8 in regulating caspase-1 activation following inflammasome activation
25349211 SCCRO3 functions as a tumor suppressor by antagonizing the neddylation activity of SCCRO
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
24949976 Study reports the structure of a trapped RING E3-E2 approximately UBL-target intermediate representing RBX1-UBC12 approximately NEDD8-CUL1-DCN1, which reveals the mechanism of NEDD8 ligation and how a particular UBL and acceptor lysine are matched by a multifunctional RING E3.
More...

AA Sequence

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV      1 - 70
LALRGGGGLRQ                                                                71 - 81
//

Text Mined References (110)

PMID Year Title
26632597 2015 Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.
26003431 2015 NEDD8-mediated neddylation is required for human endometrial stromal proliferation and decidualization.
25918018 2015 A lysine-to-arginine mutation on NEDD8 markedly reduces the activity of cullin RING E3 ligase through the impairment of neddylation cascades.
25782162 2015 Targeting protein neddylation with an NEDD8-activating enzyme inhibitor MLN4924 induced apoptosis or senescence in human lymphoma cells.
25655932 2015 NEDDylation promotes endothelial dysfunction: a role for HDAC2.
25452302 2015 Nedd8 regulates inflammasome-dependent caspase-1 activation.
25416956 2014 A proteome-scale map of the human interactome network.
25349211 2014 SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
24949976 2014 Structure of a RING E3 trapped in action reveals ligation mechanism for the ubiquitin-like protein NEDD8.
More...