Property Summary

NCBI Gene PubMed Count 45
PubMed Score 197.26
PubTator Score 107.48

Knowledge Summary

Patent (2,426)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.433 9.9e-04
Breast cancer 2.800 2.7e-02
cystic fibrosis 1.744 1.4e-06
dermatomyositis 1.300 9.1e-03
ductal carcinoma in situ -1.300 2.5e-03
fibroadenoma -1.400 2.9e-02
gastric carcinoma 1.400 1.5e-02
Gaucher disease type 3 -1.200 3.8e-02
group 3 medulloblastoma 1.200 1.9e-02
interstitial cystitis 1.400 4.5e-03
intraductal papillary-mucinous adenoma (... -5.000 4.1e-07
intraductal papillary-mucinous carcinoma... -5.300 2.6e-07
intraductal papillary-mucinous neoplasm ... -5.300 3.3e-05
lung adenocarcinoma -1.200 2.6e-17
lung cancer -3.300 2.8e-06
non-small cell lung cancer -1.279 2.2e-11
ovarian cancer -2.300 3.0e-13
pancreatic cancer -1.300 4.1e-06
pancreatic ductal adenocarcinoma liver m... -1.708 5.0e-03

Gene RIF (28)

AA Sequence

MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDIFTTLVDLKWR      1 - 70
HTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVCVTNVRSFTSAFLFSIEVQVT     71 - 140
IGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMKTAQAHRRAETLIFSRHAVIAVRNGKLCFMF    141 - 210
RVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDI    211 - 280
SATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAA    281 - 350
PRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN    351 - 420
TSES                                                                      421 - 424
//

Text Mined References (46)

PMID Year Title