Property Summary

NCBI Gene PubMed Count 48
PubMed Score 89.80
PubTator Score 52.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer -1.300 1.8e-02
pancreatic cancer -1.300 2.4e-02
Multiple myeloma 1.303 9.1e-04
malignant mesothelioma -1.100 4.3e-06
esophageal adenocarcinoma -1.400 3.2e-02
osteosarcoma 1.860 1.6e-05
ependymoma 1.800 7.5e-10
atypical teratoid / rhabdoid tumor 1.100 1.5e-02
glioblastoma 1.400 6.8e-03
medulloblastoma, large-cell -1.600 5.8e-04
Atopic dermatitis -1.200 8.0e-03
primary pancreatic ductal adenocarcinoma 1.355 7.9e-03
lung cancer -1.300 3.2e-03
pediatric high grade glioma 1.300 5.2e-03
group 4 medulloblastoma -1.600 2.1e-04
pilocytic astrocytoma 1.500 9.1e-05
pancreatic carcinoma -1.300 2.4e-02
lung adenocarcinoma 1.422 2.1e-04
psoriasis 1.100 8.0e-04
invasive ductal carcinoma -1.100 4.7e-03
ovarian cancer -2.100 1.0e-09
Gaucher disease type 1 -1.400 2.4e-02
Down syndrome 2.600 7.7e-04
dermatomyositis -1.100 1.7e-02

Gene RIF (19)

PMID Text
26034069 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25209806 Liquid chromatography-MS/MS analysis showed that the HHV-6 gM/gN complex interacts with the v-SNARE protein, vesicle-associated membrane protein 3 (VAMP3).
25046114 highlight the role that VAMP3 and VAMP7 play in selection of the pathways leading to generation of ultrastructurally different LC3 compartments
25002402 phosphatidylinositol 4-kinase IIalpha knockdown inhibited vesicle-associated membrane protein 3 trafficking to perinuclear membranes and impaired the rate of VAMP3-mediated recycling of the transferrin receptor
24850728 These results indicated that Uukuniemi virus relies on VAMP3 for penetration, providing an indication of added complexity in the trafficking of viruses through the endocytic network.
24373201 Data suggest VAMP3 and SNAP23 (synaptosomal-associated protein 23 kDa) participate in interleukin-1beta-, interleukin-1 receptor-, calcium signaling-dependent secretion/exocytosis of interleukin-6 and tumor necrosis factor alpha from synoviocytes.
23813974 Genome-wide expression profiling identified the transcription of ADIPOR1, VAMP3 and C11ORF10 to be correlated with decreased ANRIL expression in a time-dependent manner.
23353890 mutation of the Godzilla ubiquitylation target lysines on VAMP3 abrogates the formation of enlarged endosomes induced by either Godzilla or RNF167.
22573826 Data suggest a new integrin trafficking pathway in which endocytosed integrins are transported from VAMP3-containing recycling endosomes to STX6-containing trans-Golgi network before being recycled to the plasma membrane.
21094665 Endothelial cells specifically select VAMP 3 over VAMP8 to cooperate with syntaxin 4 and SNAP23 in the Ca(2+)-triggered fusion of Weibel-Palade bodies with the plasma membrane.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20299515 HIV-1 Nef impairs the recruitment of VAMP3-positive endosomes at the site of phagocytosis
19910495 the importance of VAMP3 in the trafficking of matrix metalloproteinases during degradation of extracellular matrix substrates and subsequent cellular invasion
19781582 TI-VAMP/VAMP7 and VAMP3/cellubrevin: two v-SNARE proteins involved in specific steps of the autophagy/multivesicular body pathways.
19159614 VAMP3-dependent integrin trafficking is crucial in cell migration and cell adhesion to laminin.
18628682 These results do not suggest that a common genetic variant at VAMP2 or VAMP3 contributes to the development of bipolar affective disorder in German patients.
18628682 Observational study of gene-disease association. (HuGE Navigator)
12130530 VAMP-3 and VAMP-8 are present in human platelets and are required for granule secretion.
11809765 Hyperacidification of cellubrevin endocytic compartments and defective endosomal recycling in cystic fibrosis respiratory epithelial cells

AA Sequence

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRK      1 - 70
YWWKNCKMWAIGITVLVIFIIIIIVWVVSS                                             71 - 100
//

Text Mined References (53)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
26034069 2015 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25209806 2014 Human herpesvirus 6 gM/gN complex interacts with v-SNARE in infected cells.
25046114 2014 Role of VAMP3 and VAMP7 in the commitment of Yersinia pseudotuberculosis to LC3-associated pathways involving single- or double-membrane vacuoles.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24850728 2014 Genome-wide small interfering RNA screens reveal VAMP3 as a novel host factor required for Uukuniemi virus late penetration.
24373201 2014 SNAP-23 and VAMP-3 contribute to the release of IL-6 and TNF? from a human synovial sarcoma cell line.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055037 2013 Syntaxin-4 is essential for IgE secretion by plasma cells.
23813974 2013 The large non-coding RNA ANRIL, which is associated with atherosclerosis, periodontitis and several forms of cancer, regulates ADIPOR1, VAMP3 and C11ORF10.
23353890 2013 Goliath family E3 ligases regulate the recycling endosome pathway via VAMP3 ubiquitylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22589474 2012 Granule exocytosis is required for platelet spreading: differential sorting of ?-granules expressing VAMP-7.
22573826 2012 Regulation of integrin endocytic recycling and chemotactic cell migration by syntaxin 6 and VAMP3 interaction.
22144578 2012 VAMP8 is a vesicle SNARE that regulates mucin secretion in airway goblet cells.
22118466 2011 The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21094665 2011 VAMP3 is associated with endothelial weibel-palade bodies and participates in their Ca(2+)-dependent exocytosis.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
19910495 2009 VAMP3, syntaxin-13 and SNAP23 are involved in secretion of matrix metalloproteinases, degradation of the extracellular matrix and cell invasion.
19781582 2009 TI-VAMP/VAMP7 and VAMP3/cellubrevin: two v-SNARE proteins involved in specific steps of the autophagy/multivesicular body pathways.
19478182 2009 A role for the CHC22 clathrin heavy-chain isoform in human glucose metabolism.
19159614 2009 Silencing of VAMP3 inhibits cell migration and integrin-mediated adhesion.
19061864 2009 Rap2 function requires palmitoylation and recycling endosome localization.
18628682 2008 Association study between genetic variants at the VAMP2 and VAMP3 loci and bipolar affective disorder.
18253931 2008 Vesicle associated membrane protein (VAMP)-7 and VAMP-8, but not VAMP-2 or VAMP-3, are required for activation-induced degranulation of mature human mast cells.
18195106 2008 A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15525538 2004 ACAP1 promotes endocytic recycling by recognizing recycling sorting signals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12828989 2003 Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130530 2002 Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion.
11839770 2002 Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform.
11786915 2002 Crystal structure of the endosomal SNARE complex reveals common structural principles of all SNAREs.
11278762 2001 Syntaxin 7 complexes with mouse Vps10p tail interactor 1b, syntaxin 6, vesicle-associated membrane protein (VAMP)8, and VAMP7 in b16 melanoma cells.
11101518 2000 A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function.
10820264 2000 Soluble NSF attachment protein receptors (SNAREs) in RBL-2H3 mast cells: functional role of syntaxin 4 in exocytosis and identification of a vesicle-associated membrane protein 8-containing secretory compartment.
9885218 1999 Identification of a cellubrevin/vesicle associated membrane protein 3 homologue in human platelets.
9817754 1998 Syntaxin 13 mediates cycling of plasma membrane proteins via tubulovesicular recycling endosomes.
9701566 1998 Interaction of Munc-18-2 with syntaxin 3 controls the association of apical SNAREs in epithelial cells.
9614185 1998 A novel tetanus neurotoxin-insensitive vesicle-associated membrane protein in SNARE complexes of the apical plasma membrane of epithelial cells.
9396746 1997 Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31.
8973549 1996 Identification of SNAP receptors in rat adipose cell membrane fractions and in SNARE complexes co-immunoprecipitated with epitope-tagged N-ethylmaleimide-sensitive fusion protein.