Property Summary

NCBI Gene PubMed Count 48
Grant Count 34
R01 Count 19
Funding $3,129,107.56
PubMed Score 89.80
PubTator Score 52.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer -1.300 0.018
pancreatic cancer -1.300 0.024
Multiple myeloma 1.303 0.001
malignant mesothelioma -1.100 0.000
esophageal adenocarcinoma -1.400 0.032
osteosarcoma 1.860 0.000
ependymoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.100 0.015
glioblastoma 1.400 0.007
medulloblastoma, large-cell -1.600 0.001
Atopic dermatitis -1.200 0.008
primary pancreatic ductal adenocarcinoma 1.355 0.008
lung cancer -1.300 0.003
pediatric high grade glioma 1.300 0.005
group 4 medulloblastoma -1.600 0.000
pilocytic astrocytoma 1.500 0.000
pancreatic carcinoma -1.300 0.024
lung adenocarcinoma 1.422 0.000
psoriasis 1.100 0.001
invasive ductal carcinoma -1.100 0.005
ovarian cancer -2.100 0.000
Gaucher disease type 1 -1.400 0.024
Down syndrome 2.600 0.001
dermatomyositis -1.100 0.017

Gene RIF (19)

PMID Text
26034069 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25209806 Liquid chromatography-MS/MS analysis showed that the HHV-6 gM/gN complex interacts with the v-SNARE protein, vesicle-associated membrane protein 3 (VAMP3).
25046114 highlight the role that VAMP3 and VAMP7 play in selection of the pathways leading to generation of ultrastructurally different LC3 compartments
25002402 phosphatidylinositol 4-kinase IIalpha knockdown inhibited vesicle-associated membrane protein 3 trafficking to perinuclear membranes and impaired the rate of VAMP3-mediated recycling of the transferrin receptor
24850728 These results indicated that Uukuniemi virus relies on VAMP3 for penetration, providing an indication of added complexity in the trafficking of viruses through the endocytic network.
24373201 Data suggest VAMP3 and SNAP23 (synaptosomal-associated protein 23 kDa) participate in interleukin-1beta-, interleukin-1 receptor-, calcium signaling-dependent secretion/exocytosis of interleukin-6 and tumor necrosis factor alpha from synoviocytes.
23813974 Genome-wide expression profiling identified the transcription of ADIPOR1, VAMP3 and C11ORF10 to be correlated with decreased ANRIL expression in a time-dependent manner.
23353890 mutation of the Godzilla ubiquitylation target lysines on VAMP3 abrogates the formation of enlarged endosomes induced by either Godzilla or RNF167.
22573826 Data suggest a new integrin trafficking pathway in which endocytosed integrins are transported from VAMP3-containing recycling endosomes to STX6-containing trans-Golgi network before being recycled to the plasma membrane.
21094665 Endothelial cells specifically select VAMP 3 over VAMP8 to cooperate with syntaxin 4 and SNAP23 in the Ca(2+)-triggered fusion of Weibel-Palade bodies with the plasma membrane.
More...

AA Sequence

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRK      1 - 70
YWWKNCKMWAIGITVLVIFIIIIIVWVVSS                                             71 - 100
//

Text Mined References (53)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
26034069 2015 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25209806 2014 Human herpesvirus 6 gM/gN complex interacts with v-SNARE in infected cells.
25046114 2014 Role of VAMP3 and VAMP7 in the commitment of Yersinia pseudotuberculosis to LC3-associated pathways involving single- or double-membrane vacuoles.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24850728 2014 Genome-wide small interfering RNA screens reveal VAMP3 as a novel host factor required for Uukuniemi virus late penetration.
24373201 2014 SNAP-23 and VAMP-3 contribute to the release of IL-6 and TNF? from a human synovial sarcoma cell line.
More...