Property Summary

NCBI Gene PubMed Count 36
Grant Count 174
R01 Count 154
Funding $17,321,670.99
PubMed Score 81.47
PubTator Score 58.37

Knowledge Summary

Patent (3,159)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.005

Synonym

Accession Q15835 Q53X14 RK
Symbols RK
RHOK
GPRK1

Gene

PDB

5AFP  

Gene RIF (15)

PMID Text
26349155 The identification of the c.1607_1610delCGGA mutation in a patient with Oguchi disease confirms the pathogenicity of this variant.
25979333 In the Ca(2+)/NCS-1.D2R peptide complex, the C-terminal region adopts a 310 helix-turn-310 helix, whereas in the GRK1 peptide complex it forms an a-helix
24670923 Rho-kinase activity exhibits distinct circadian variation associated with alterations in coronary vasomotor responses and autonomic activity in VSA patients.
22959359 The selective thinning of the inner retinal layers in patients with GRM6 mutations suggests either reduced bipolar or ganglion cell numbers or altered synaptic structure in the inner retina.
22183412 Defects in GRK1 or GRK7 cause patients to suffer from an inability to properly deactivate rhodopsin leading to problems with recovery and dark adaptation.
21922265 There are two genes that cause Oguchi disease: the G protein-coupled receptor kinase 1 gene and the S antigen gene. There is evidence that Oguchi disease and retinitis pigmentosa (RP) can coexist in the same family or even in the same individual
19753316 Genetic mapping supported the diagnosis of typical Oguchi disease in a Pakistani family and also resulted in the identification of a novel nonsense mutation (c.614C>A; p.S205X) in exon 1 of GRK1.
18266817 A GRK1 region close to its C-terminus also seemed to be the binding site for S-modulin/recoverin.
17765441 The authors found two different novel mutations in Japanese patients. The results indicate that a considerable number of GRK1 mutations exist in the Japanese population.
17524610 Conserved bicoid homeodomain factors thus appear to be the key factors governing localization of GRK1 Enhancer/Promoter activity in retina and photoreceptors.
More...

AA Sequence

MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKK      1 - 70
LFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVE     71 - 140
IQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQPMGEDWFLDFRVLGKGGFGEVSACQMK    141 - 210
ATGKLYACKKLNKKRLKKRKGYQGAMVEKKILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIY    211 - 280
NVNEENPGFPEPRALFYTAQIICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTK    281 - 350
GYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS    351 - 420
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAF    421 - 490
STVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMC    491 - 560
LVS                                                                       561 - 563
//

Text Mined References (37)

PMID Year Title
26349155 2015 The first case of Oguchi disease, type 2 in a Polish patient with confirmed GRK1 gene mutation.
25979333 2015 Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-protein-coupled Receptor Kinase 1 (GRK1) Peptides Using Different Modes of Interactions.
24670923 2014 Circadian variation of Rho-kinase activity in circulating leukocytes of patients with vasospastic angina.
22959359 2012 Assessing retinal structure in complete congenital stationary night blindness and Oguchi disease.
22183412 2012 A tale of two kinases in rods and cones.
21922265 2011 Oguchi disease masked by retinitis pigmentosa.
19753316 2009 A novel mutation in GRK1 causes Oguchi disease in a consanguineous Pakistani family.
18266817 Amino acid residues in GRK1/GRK7 responsible for interaction with S-modulin/recoverin.
17765441 2007 Novel mutations in the GRK1 gene in Japanese patients With Oguchi disease.
17524610 2007 Conserved interactions of a compact highly active enhancer/promoter upstream of the rhodopsin kinase (GRK1) gene.
More...