Property Summary

NCBI Gene PubMed Count 16
PubMed Score 62.23
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 1.1e-04
astrocytic glioma -1.200 1.3e-02
atypical teratoid / rhabdoid tumor -1.100 7.5e-05
ependymoma -1.500 8.5e-03
glioblastoma -1.100 2.8e-06
group 3 medulloblastoma -1.400 1.3e-03
intraductal papillary-mucinous adenoma (... -1.400 1.0e-03
intraductal papillary-mucinous carcinoma... -1.500 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.5e-03
malignant mesothelioma -2.800 4.7e-07
Multiple myeloma 1.523 4.3e-02
nephrosclerosis 1.377 1.1e-04
ovarian cancer 2.400 2.1e-07
primitive neuroectodermal tumor -1.900 3.9e-05
psoriasis 1.500 2.1e-04
subependymal giant cell astrocytoma -1.294 2.8e-02
tuberculosis 1.100 2.5e-08

Gene RIF (2)

AA Sequence

MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRL      1 - 70
QAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKEL     71 - 140
CLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD            141 - 202
//

Text Mined References (18)

PMID Year Title