Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
Funding $2,808,608.5
PubMed Score 59.05
PubTator Score 10.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
17014843 DIPA can act as a repressor of gene transcription, an activity that appears to be enhanced by p78.
15644333 DIPA is a novel partner of C/EBP beta that down-regulates early events of adipogenesis.

AA Sequence

MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRL      1 - 70
QAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKEL     71 - 140
CLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD            141 - 202
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17873903 2008 Coiled-coil domain containing 85B suppresses the beta-catenin activity in a p53-dependent manner.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17014843 2006 DIPA, which can localize to the centrosome, associates with p78/MCRS1/MSP58 and acts as a repressor of gene transcription.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15644333 2005 Delta-interacting protein A, a new inhibitory partner of CCAAT/enhancer-binding protein beta, implicated in adipocyte differentiation.
More...