Property Summary

NCBI Gene PubMed Count 50
PubMed Score 37.04
PubTator Score 35.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
COPD -1.100 1.1e-03
osteosarcoma 1.294 5.4e-07
psoriasis -1.200 2.6e-04
Rheumatoid arthritis -1.700 3.5e-02

Synonym

Accession Q15833 B4E175 E7EQD5 Q9BU65
Symbols FHL5
UNC18B
Hunc18b
UNC18-2
pp10122
MUNC18-2

Gene

PDB

4CCA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (25)

AA Sequence

MAPSGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPS      1 - 70
LEAIYLLSPTEKSVQALIKDFQGTPTFTYKAAHIFFTDTCPEPLFSELGRSRLAKVVKTLKEIHLAFLPY     71 - 140
EAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLN    141 - 210
AFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELTFQAMAYDLLDIEQDTYRYETTGLSEAREKAVL    211 - 280
LDEDDDLWVELRHMHIADVSKKVTELLRTFCESKRLTTDKANIKDLSQILKKMPQYQKELNKYSTHLHLA    281 - 350
DDCMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYDKIRVLLLYILLRNGVSEE    351 - 420
NLAKLIQHANVQAHSSLIRNLEQLGGTVTNPGGSGTSSRLEPRERMEPTYQLSRWTPVIKDVMEDAVEDR    421 - 490
LDRNLWPFVSDPAPTASSQAAVSARFGHWHKNKAGIEARAGPRLIVYVMGGVAMSEMRAAYEVTRATEGK    491 - 560
WEVLIGSSHILTPTRFLDDLKALDKKLEDIALP                                         561 - 593
//

Text Mined References (55)

PMID Year Title