Tchem | Serine/threonine-protein kinase STK11 |
Isoform 2: Has a role in spermiogenesis.
This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Hamman-Rich syndrome | 35 |
non-small cell lung cancer | 2798 |
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 2.15023028469457E-9 |
psoriasis | 6685 | 1.00154737861645E-4 |
ovarian cancer | 8492 | 7.87054005141921E-4 |
non primary Sjogren syndrome sicca | 840 | 0.0139887091785205 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Breast cancer | 3099 | 0.0 | 5.0 |
Disease | log2 FC | p |
---|---|---|
psoriasis | 1.300 | 0.000 |
osteosarcoma | -3.699 | 0.000 |
diabetes mellitus | -1.200 | 0.002 |
non primary Sjogren syndrome sicca | 1.100 | 0.014 |
ovarian cancer | 1.100 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
C. elegans | EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
PMID | Text |
---|---|
27060312 | Mutations of the STK11 gene are the major cause of Peutz-Jeghers syndrome. |
27035914 | results suggest that decreased LKB1 expression in patients with solid tumors might be related to poor prognosis and serve as a potential predictive marker of poor clinicopathological prognostic factors |
26976973 | Results show the expression of LKB1 mRNA and protein lower in gastric-cancer cell lines and tumor tissues compared to normal gastric cells correlated with poor prognosis with a lower survival rate. |
26833127 | STK11/LKB1-inactivating mutations were associated with reduced expression of PD-1 ligand PD-L1 in mouse and patient tumors as well as in tumor-derived cell lines. |
26662608 | we present two elderly patients with thyroid carcinoma harboring STK11 mutation without clinical manifestation of Peutz-Jeghers syndrome. The findings suggest that STK11 may play a role in thyroid carcinoma development. |
26616116 | The present study aimed to compare the expression of liver kinase B1 (LKB1) in prostate cancer (PCa) tissues and the paired adjacent tissues, then to evaluate the statistical relationship between LKB1 expression and prognosis of PCa patients. |
26607058 | We found seven novel and four recurrent STK11 gene mutations in Chinese children with PJS. |
26549522 | the expression of LKB1 was reduced in the gastric cancer tissues |
26517522 | Data show that integrin beta3 and serine/threonine-protein kinase LKB1 are involved in the inhibition of proliferation by lovastatin independently. |
26479318 | Studies indicate link between the 6-phosphogluconate dehydrogenase, oxidative pentose phosphate pathway (PPP) and lipogenesis through Ru-5-P-dependent inhibition of serine/threonine protein kinase LKB1-AMPK signalling. |
More... |
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE 1 - 70 TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML 71 - 140 DSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC 141 - 210 RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP 211 - 280 PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED 281 - 350 EDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA 351 - 420 SSKIRRLSACKQQ 421 - 433 //
PMID | Year | Title |
---|---|---|
27060312 | 2016 | [Mutations of the STK11 and FHIT genes among patients with Peutz-Jeghers syndrome]. |
27035914 | 2016 | The Prognostic Value of Decreased LKB1 in Solid Tumors: A Meta-Analysis. |
26976973 | 2016 | Decreased Expression of Tumor-suppressor Gene LKB1 Correlates with Poor Prognosis in Human Gastric Cancer. |
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26833127 | 2016 | STK11/LKB1 Deficiency Promotes Neutrophil Recruitment and Proinflammatory Cytokine Production to Suppress T-cell Activity in the Lung Tumor Microenvironment. |
26662608 | 2016 | STK11 Mutation Identified in Thyroid Carcinoma. |
26616116 | 2015 | Low LKB1 Expression Results in Unfavorable Prognosis in Prostate Cancer Patients. |
26607058 | 2015 | Clinical characteristics and STK11 gene mutations in Chinese children with Peutz-Jeghers syndrome. |
26549522 | 2016 | Clinical significance and role of LKB1 in gastric cancer. |
26517522 | 2016 | Integrin ?3 and LKB1 are independently involved in the inhibition of proliferation by lovastatin in human intrahepatic cholangiocarcinoma. |
More... |