Property Summary

NCBI Gene PubMed Count 334
Grant Count 427
R01 Count 213
Funding $43,731,923.59
PubMed Score 899.74
PubTator Score 708.57

Knowledge Summary

Patent (22,201)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.000
osteosarcoma -3.699 0.000
diabetes mellitus -1.200 0.002
non primary Sjogren syndrome sicca 1.100 0.014
ovarian cancer 1.100 0.001

Synonym

Accession Q15831 B2RBX7 E7EW76
Symbols PJS
LKB1
hLKB1

Gene

PDB

2WTK   4ZDR  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (309)

PMID Text
27060312 Mutations of the STK11 gene are the major cause of Peutz-Jeghers syndrome.
27035914 results suggest that decreased LKB1 expression in patients with solid tumors might be related to poor prognosis and serve as a potential predictive marker of poor clinicopathological prognostic factors
26976973 Results show the expression of LKB1 mRNA and protein lower in gastric-cancer cell lines and tumor tissues compared to normal gastric cells correlated with poor prognosis with a lower survival rate.
26833127 STK11/LKB1-inactivating mutations were associated with reduced expression of PD-1 ligand PD-L1 in mouse and patient tumors as well as in tumor-derived cell lines.
26662608 we present two elderly patients with thyroid carcinoma harboring STK11 mutation without clinical manifestation of Peutz-Jeghers syndrome. The findings suggest that STK11 may play a role in thyroid carcinoma development.
26616116 The present study aimed to compare the expression of liver kinase B1 (LKB1) in prostate cancer (PCa) tissues and the paired adjacent tissues, then to evaluate the statistical relationship between LKB1 expression and prognosis of PCa patients.
26607058 We found seven novel and four recurrent STK11 gene mutations in Chinese children with PJS.
26549522 the expression of LKB1 was reduced in the gastric cancer tissues
26517522 Data show that integrin beta3 and serine/threonine-protein kinase LKB1 are involved in the inhibition of proliferation by lovastatin independently.
26479318 Studies indicate link between the 6-phosphogluconate dehydrogenase, oxidative pentose phosphate pathway (PPP) and lipogenesis through Ru-5-P-dependent inhibition of serine/threonine protein kinase LKB1-AMPK signalling.
More...

AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE      1 - 70
TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML     71 - 140
DSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC    141 - 210
RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP    211 - 280
PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED    281 - 350
EDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA    351 - 420
SSKIRRLSACKQQ                                                             421 - 433
//

Text Mined References (355)

PMID Year Title
27060312 2016 [Mutations of the STK11 and FHIT genes among patients with Peutz-Jeghers syndrome].
27035914 2016 The Prognostic Value of Decreased LKB1 in Solid Tumors: A Meta-Analysis.
26976973 2016 Decreased Expression of Tumor-suppressor Gene LKB1 Correlates with Poor Prognosis in Human Gastric Cancer.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26833127 2016 STK11/LKB1 Deficiency Promotes Neutrophil Recruitment and Proinflammatory Cytokine Production to Suppress T-cell Activity in the Lung Tumor Microenvironment.
26662608 2016 STK11 Mutation Identified in Thyroid Carcinoma.
26616116 2015 Low LKB1 Expression Results in Unfavorable Prognosis in Prostate Cancer Patients.
26607058 2015 Clinical characteristics and STK11 gene mutations in Chinese children with Peutz-Jeghers syndrome.
26549522 2016 Clinical significance and role of LKB1 in gastric cancer.
26517522 2016 Integrin ?3 and LKB1 are independently involved in the inhibition of proliferation by lovastatin in human intrahepatic cholangiocarcinoma.
More...