Property Summary

Ligand Count 2
NCBI Gene PubMed Count 367
PubMed Score 998.28
PubTator Score 708.57

Knowledge Summary

Patent (22,201)

TINX Plot

  Disease (9)

Disease Target Count P-value
osteosarcoma 7950 2.2e-09
psoriasis 6694 1.0e-04
diabetes mellitus 1728 1.5e-03
non primary Sjogren syndrome sicca 891 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.6
Cervix carcinoma 10 0.0 0.6
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
ovarian cancer 1.100 7.9e-04
diabetes mellitus -1.200 1.5e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
osteosarcoma -3.699 2.2e-09
psoriasis 1.300 1.0e-04

Gene RIF (342)

AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSE      1 - 70
TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEML     71 - 140
DSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTC    141 - 210
RTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGP    211 - 280
PLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADED    281 - 350
EDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA    351 - 420
SSKIRRLSACKQQ                                                             421 - 433
//

Text Mined References (388)

PMID Year Title