Property Summary

NCBI Gene PubMed Count 39
Grant Count 2
Funding $68,661
PubMed Score 41.21
PubTator Score 53.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -2.200 0.032
psoriasis -2.300 0.000
Atopic dermatitis -3.500 0.000
non-small cell lung cancer -2.044 0.000
pancreatic cancer 1.300 0.016
lung adenocarcinoma -1.100 0.033
nasopharyngeal carcinoma -1.200 0.000
ductal carcinoma in situ 1.700 0.024
invasive ductal carcinoma 1.400 0.023
ovarian cancer -2.400 0.000

Gene RIF (25)

PMID Text
24742492 Low CST6 expression is associated with breast cancer.
23088560 Developed a Methylation-Sensitive High Resolution Melting Analysis (MS-HRMA) assay for the investigation of CST6 promoter methylation in breast cancer patients.CST6 promoter was methylated in 39/80 of FFPEs.
23006792 The CST6 promoter is highly methylated in circulating cell-free DNA of breast cancer patients, but not in healthy individuals.
22902879 Data show a regulatory role of cystatin E/M in controlling both intra- and extracellular legumain activity.
22688893 The ectopic expression of CST6 in cancer cells rescued mice from overt osteolytic metastasis and deaths in the animal study, while CST6 knockdown markedly enhanced cancer cell bone metastasis and shortened animal survival.
21092257 An association between the quantity of CST6 methylation and the expression statuses of estrogen receptor, progesterone receptor, and HER4 in tumor tissues was found
20074384 the level of cystatin E/M regulates legumain activity and hence the invasive potential of human melanoma cells
19551853 Methylation of cystatin M promoter is associated with breast cancer.
19503093 Results suggest that the downregulation of the CST6 gene is associated with promoter histone modifications and that this association plays an important role in prostate cancer progression during the invasive and metastatic stages of the disease.
19262604 cystatin M/E has a role in skin barrier formation and a potential role as a tumor suppressor gene [review]
More...

AA Sequence

MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFR      1 - 70
DTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQ     71 - 140
LLKHNCVQM                                                                 141 - 149
//

Text Mined References (39)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24742492 2014 TBX2 represses CST6 resulting in uncontrolled legumain activity to sustain breast cancer proliferation: a novel cancer-selective target pathway with therapeutic opportunities.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23088560 2012 A closed-tube methylation-sensitive high resolution melting assay (MS-HRMA) for the semi-quantitative determination of CST6 promoter methylation in clinical samples.
23006792 2013 CST6 promoter methylation in circulating cell-free DNA of breast cancer patients.
22902879 2012 Intra- and extracellular regulation of activity and processing of legumain by cystatin E/M.
22688893 2012 Differential secretome analysis reveals CST6 as a suppressor of breast cancer bone metastasis.
21092257 2010 Cystatin M loss is associated with the losses of estrogen receptor, progesterone receptor, and HER4 in invasive breast cancer.
20074384 2010 Cystatin E/M suppresses legumain activity and invasion of human melanoma.
More...