Property Summary

NCBI Gene PubMed Count 49
Grant Count 17
R01 Count 9
Funding $1,060,721.91
PubMed Score 13.46
PubTator Score 16.09

Knowledge Summary

Patent (428)

Gene RIF (39)

PMID Text
25823894 Polymorphism in CHRNA6 gene is associated with esophageal adenocarcinoma.
25068303 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure.
24886653 N-terminal alpha-helix (Asp57); complementary face/inner beta-fold (Arg87 or Asp92) and principal face/outer beta-fold (Ser156 or Asn171) residues in the halpha6 subunit are crucial for functional expression.
24792900 these results demonstrate that the combined effect of rs6474412-C/T polymorphism in smoking-related CHRNB3-CHRNA6 region gene and smoking behavior may not confer risk to psoriasis vulgaris (PV), but may have impact on PV severity in Chinese Han population.
24675634 the CHRNB3-A6 locus contains multiple variants affecting risk for vulnerability to cocaine and nicotine dependence as well as bipolar disorder, suggesting that they have pleiotropic effects.
24401102 The common variant rs13273442 in the CHRNB3-CHNRA6 region is associated significantly with nicotine dependence in European Americans and African Americans.
24253422 findings indicate that both CHRNA2 and CHRNA6 play a significant role in the etiology of ND in AA and EA smokers
24085295 Elucidation of molecular impediments in the alpha6 subunit for in vitro expression of functional alpha6beta4* nicotinic acetylcholine receptors.
23899432 Results demonstrate the association between SNPs in CHRNA6 nicotinic acetylcholine receptor genes and the risk of smoking in ADHD
23227187 Cross sectional data of US adults from the NHANES linked with genotype and geocodes were used to identify tobacco use phenotypes, state-level taxation rates, and variation in the nicotinic acetylcholine receptor (CHRNA6) genotype
More...

AA Sequence

MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQL      1 - 70
ANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALL     71 - 140
KYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIID    141 - 210
ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLL    211 - 280
SLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLP    281 - 350
QVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV    351 - 420
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGN    421 - 490
TGKS                                                                      491 - 494
//

Text Mined References (51)

PMID Year Title
25823894 2015 A genetic variant in CHRNB3-CHRNA6 increases risk of esophageal squamous cell carcinoma in Chinese populations.
25068303 2014 Efficient expression of functional (?6?2)2?3 AChRs in Xenopus oocytes from free subunits using slightly modified ?6 subunits.
24886653 2014 Analysis of rare variations reveals roles of amino acid residues in the N-terminal extracellular domain of nicotinic acetylcholine receptor (nAChR) alpha6 subunit in the functional expression of human alpha6*-nAChRs.
24792900 2014 Combined effect between CHRNB3-CHRNA6 region gene variant (rs6474412) and smoking in psoriasis vulgaris severity.
24675634 2014 Variants near CHRNB3-CHRNA6 are associated with DSM-5 cocaine use disorder: evidence for pleiotropy.
24401102 2014 Multiple distinct CHRNB3-CHRNA6 variants are genetic risk factors for nicotine dependence in African Americans and European Americans.
24253422 2014 Significant associations of CHRNA2 and CHRNA6 with nicotine dependence in European American and African American populations.
24085295 2013 Elucidation of molecular impediments in the ?6 subunit for in vitro expression of functional ?6?4* nicotinic acetylcholine receptors.
23899432 2013 Nicotinic receptor gene variants interact with attention deficient hyperactive disorder symptoms to predict smoking trajectories from early adolescence to adulthood.
23227187 2012 Why have tobacco control policies stalled? Using genetic moderation to examine policy impacts.
More...