Property Summary

Ligand Count 1
NCBI Gene PubMed Count 52
PubMed Score 13.97
PubTator Score 16.09

Knowledge Summary

Patent (428)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.400 2.2e-25

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (41)

AA Sequence

MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQL      1 - 70
ANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALL     71 - 140
KYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIID    141 - 210
ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLL    211 - 280
SLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLP    281 - 350
QVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV    351 - 420
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGN    421 - 490
TGKS                                                                      491 - 494
//

Text Mined References (54)

PMID Year Title