Property Summary

Ligand Count 3
NCBI Gene PubMed Count 45
PubMed Score 18.28
PubTator Score 33.15

Knowledge Summary

Patent (825)


  Differential Expression (3)

Disease log2 FC p
lung carcinoma 1.800 5.4e-29
osteosarcoma 1.282 1.1e-07
psoriasis -2.100 1.1e-19

Gene RIF (33)

AA Sequence

EDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI                                   491 - 529

Text Mined References (46)

PMID Year Title