Property Summary

NCBI Gene PubMed Count 33
Grant Count 22
R01 Count 18
Funding $1,317,579.12
PubMed Score 49.67
PubTator Score 35.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.000 0.003
ependymoma -1.900 0.009
oligodendroglioma -1.900 0.007
glioblastoma multiforme -1.200 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
adult high grade glioma -1.300 0.000
Pick disease -1.600 0.003
ovarian cancer 1.700 0.001

Gene RIF (13)

PMID Text
26148049 Data suggest that ubiquitin-conjugating enzyme E2 variant 2 (Ube2V2) and ring finger protein 4 (RNF4) together induce an active conformation of the ubiquitin-conjugating enzyme Ubc13-ubiquitin (Ubc13~Ub) thioester.
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
24846979 suppression of hMMS2 reverses L-OHP tolerance in differentiated human colorectal carcinoma cells by promoting apoptosis
22679021 the crystal structure of human OTUB1 in complex with human UBC13 and MMS2
22589545 Data show RING finger (RNF) E3 ubiquitin ligase RNF8 dimerizes and binds to E2 ubiquitin-conjugating complex Ubc13/Mms2 with formation of Lys-63 ubiquitin chains, whereas the RNF168 RING domain is a monomer and does not catalyze Lys-6 ubiquitylation.
21774837 entire coding region and splice junctions of RNF8, UBC13 and MMS2 genes were screened for mutations in affected index cases from 123 Northern Finnish breast cancer families
18284681 These results point to a high level of redundancy in the DNA damage tolerance pathway and suggest the existence of another hMMS2 variant (hMMSv) or complex that can compensate for its loss.
17964296 Mms2 physical association with ubiquitin is correlated with its ability to promote Lys63-linked ubiquitin chain assembly
16129784 Data demonstrate that divergent activities of Ubc13 rely on its pairing with either of two Uevs, Uev1A or Mms2.
15952783 Insight into the influence of protein dynamics on the affinity of ubiquitin for Mms2.
More...

AA Sequence

MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG      1 - 70
PKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG     71 - 140
QTYNN                                                                     141 - 145
//

Text Mined References (37)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26148049 2015 Structural basis for the RING-catalyzed synthesis of K63-linked ubiquitin chains.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
24846979 2014 [Roles of hMMS2 gene in reversing the oxaliplatin tolerance of human colon carcinoma cells].
24076975 2013 The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22679021 2012 Molecular basis of Lys-63-linked polyubiquitination inhibition by the interaction between human deubiquitinating enzyme OTUB1 and ubiquitin-conjugating enzyme UBC13.
22589545 2012 Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.
More...