Property Summary

NCBI Gene PubMed Count 14
PubMed Score 29.91
PubTator Score 126.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.000 3.4e-03
astrocytic glioma -2.700 3.3e-03
Astrocytoma, Pilocytic -3.100 6.3e-06
atypical teratoid / rhabdoid tumor -3.400 2.7e-07
colon cancer -2.600 1.9e-05
ependymoma -3.400 1.9e-03
glioblastoma -2.600 6.8e-05
lung adenocarcinoma 1.300 4.7e-02
lung carcinoma 1.500 5.1e-13
malignant mesothelioma 3.000 6.6e-06
medulloblastoma -1.200 1.5e-02
medulloblastoma, large-cell -1.300 6.0e-03
oligodendroglioma -2.600 4.5e-17
ovarian cancer -1.300 2.0e-06
pituitary cancer -1.300 3.2e-03
primitive neuroectodermal tumor -3.600 3.8e-04
psoriasis -2.600 5.1e-04
subependymal giant cell astrocytoma -4.364 3.4e-03

Gene RIF (8)

AA Sequence

MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKE      1 - 70
TILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSL     71 - 140
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQ    141 - 210
RISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQAN    211 - 280
ELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQ    281 - 350
GVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA    351 - 420
TKWTFEACRQIN                                                              421 - 432
//

Text Mined References (14)

PMID Year Title