Property Summary

NCBI Gene PubMed Count 14
Grant Count 84
R01 Count 68
Funding $8,740,846.22
PubMed Score 27.63
PubTator Score 126.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 3.000 0.000
astrocytoma -2.800 0.001
posterior fossa group B ependymoma -3.900 0.000
psoriasis -3.300 0.000
glioblastoma -3.800 0.000
oligodendroglioma -2.600 0.000
medulloblastoma -2.000 0.001
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -1.300 0.006
primitive neuroectodermal tumor -3.600 0.000
colon cancer -2.600 0.000
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -3.200 0.000
subependymal giant cell astrocytoma -4.364 0.003
lung adenocarcinoma 1.300 0.047
lung carcinoma 1.500 0.000
ovarian cancer -1.300 0.000
pituitary cancer -1.300 0.003

Synonym

Accession Q15818 B3KXH3 Q5FWE6 NP1
Symbols NP1

Gene

Gene RIF (8)

PMID Text
26038830 findings suggest that lower NARP mRNA expression contributes to lower excitatory drive onto parvalbumin interneurons in schizophrenia.
25646694 These results suggest that NPTX1 hypermethylation and consequent mRNA changes might be an important molecular mechanism in lung cancer.
25498504 Taken together, these results demonstrate that NP1 gene is a target of as hypoxia inducible factor-1 alpha and it regulates NP1 expression by binding to hypoxia responsive elements in its promoter region.
25053281 NPTX1 was significantly associated with bipolar disorder.
25029423 Long acting progestin contraceptive-enhanced NPTX1 secretion and reactive oxygen species generation in endometrial stromal cells impair endometrial endothelial cells survival resulting in a loss in vascular integrity.
24529709 NPTX1 binds and inhibits TDGF1, and reduces both Nodal and BMP signaling.
17151277 Neuronal pentraxin 1 transgene is a key factor for the synapse loss, the neurite damage, and the apoptotic neuronal death evoked by amyloid-beta protein, which regulates NP1 expression.
16115696 The purpose of the present study was to assess the toxic effect of taipoxin in SCLC-cell lines and to determine if toxicity correlates to NPR and NP1 and NP2 expression levels.

AA Sequence

MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKE      1 - 70
TILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSL     71 - 140
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQ    141 - 210
RISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQAN    211 - 280
ELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQ    281 - 350
GVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA    351 - 420
TKWTFEACRQIN                                                              421 - 432
//

Text Mined References (14)

PMID Year Title
26038830 2015 Altered Markers of Cortical ?-Aminobutyric Acid Neuronal Activity in Schizophrenia: Role of the NARP Gene.
25646694 2015 NPTX1 is a novel epigenetic regulation gene and associated with prognosis in lung cancer.
25498504 2015 Neuronal pentraxin 1 expression is regulated by hypoxia inducible factor-1?.
25053281 2015 Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder.
25029423 2014 Long-acting progestin-only contraceptives enhance human endometrial stromal cell expressed neuronal pentraxin-1 and reactive oxygen species to promote endothelial cell apoptosis.
24529709 2014 NPTX1 regulates neural lineage specification from human pluripotent stem cells.
17151277 2006 Neuronal pentraxin 1 contributes to the neuronal damage evoked by amyloid-beta and is overexpressed in dystrophic neurites in Alzheimer's brain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115696 2005 Specific sensitivity of small cell lung cancer cell lines to the snake venom toxin taipoxin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...