Property Summary

NCBI Gene PubMed Count 9
Grant Count 13
R01 Count 8
Funding $1,787,293.5
PubMed Score 24.77
PubTator Score 27.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.001
group 4 medulloblastoma 1.200 0.000
ovarian cancer 1.700 0.000

Gene RIF (3)

PMID Text
22028797 a testable model for TBCC N-terminal domain/tubulin recognition in which the highly charged N-terminus as well as residues from the three helices and the loops interact with the acidic hypervariable regions of tubulin monomers
20384997 Microtubule dynamicity was reduced in breast cancer cells overexpressing TBCC. Cell cycle distribution was altered in cells containing larger amounts of TBCC. TBCC had little effect on cell proliferation.
11847227 functional overlap with retinitis pigmenosa 2 protein

AA Sequence

MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAA      1 - 70
VEELLERAESVERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFK     71 - 140
TRGKDAASSTKVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASELHQRDVLLTE    141 - 210
LSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI    211 - 280
VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD        281 - 346
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22100072 2011 Recessive mutations in ELOVL4 cause ichthyosis, intellectual disability, and spastic quadriplegia.
22028797 2011 The solution structure of the N-terminal domain of human tubulin binding cofactor C reveals a platform for tubulin interaction.
21269460 2011 Initial characterization of the human central proteome.
20384997 2010 Tubulin binding cofactor C (TBCC) suppresses tumor growth and enhances chemosensitivity in human breast cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...