Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.91
PubTator Score 27.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-04
ovarian cancer 1.700 1.1e-06
psoriasis 1.400 5.6e-04

Gene RIF (3)

AA Sequence

MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFVRERAA      1 - 70
VEELLERAESVERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFK     71 - 140
TRGKDAASSTKVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASELHQRDVLLTE    141 - 210
LSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI    211 - 280
VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD        281 - 346
//

Text Mined References (18)

PMID Year Title