Property Summary

NCBI Gene PubMed Count 33
Grant Count 57
R01 Count 27
Funding $5,884,396.29
PubMed Score 219.10
PubTator Score 40.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.860 0.000
medulloblastoma, large-cell 1.200 0.002
lung cancer 2.200 0.000
group 3 medulloblastoma 1.200 0.000
invasive ductal carcinoma 1.200 0.003
ovarian cancer 1.400 0.001

Synonym

Accession Q15813 A8K8C2 B7Z3P1
Symbols HRD
KCS
KCS1
pac2

Gene

PDB

4ICU   4ICV  

Gene RIF (14)

PMID Text
26231322 Sanjad-Sakati syndrome molecular pathology has been shown to be due to mutations in the TBCE gene on chromosome 1q42-q43.
25908846 the role of the human TBCE and TBCB chaperones in alpha-tubulin-beta-tubulin dissociation, was investigated.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20103624 tudies confirmed elevated expression of three target antigens RAB38, TBCE, and DUSP12 in CML.
19491227 TBCE may play a role in development of the anterior pituitary, corpus callosum, and white matter in addition to the parathyroid glands.
19297412 TBCE is required for the normal development and function of neuromuscular synapses and that it promotes microtubule formation
19168853 Study demonstrates that, unlike its counterpart TBCE, TBCB only moderately destabilizes microtubules.
18262179 Depletion of Op18 by means of RNA interference increased the susceptibility of tubulin to TBCE or E-like mediated disruption, while overexpressed Op18 exerted a tubulin-protective effect.
17184771 TBCE, TBCB and alpha-tubulin form a ternary complex after heterodimer dissociation. These complexes might serve to escort alpha-tubulin towards degradation or recycling, depending on the cell requirements.
More...

AA Sequence

MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFI      1 - 70
RPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVS     71 - 140
CAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVLNVSENKLKFPSGSVLTGTLSVLKVLV    141 - 210
LNQTGITWAEVLRCVAGCPGLEELYLESNNIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLE    211 - 280
QLILSDTGISSLHFPDAGIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKE    281 - 350
AETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF    351 - 420
LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLL    421 - 490
LSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW                                     491 - 527
//

Text Mined References (40)

PMID Year Title
26231322 2015 Sanjad-Sakati syndrome in a Tunisian child.
25908846 2015 The structure of the complex between ?-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
23973072 2013 Tubulin-specific chaperones: components of a molecular machine that assembles the ?/? heterodimer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940919 2013 Autoinhibition of TBCB regulates EB1-mediated microtubule dynamics.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20204449 2010 Tubulin chaperone E binds microtubules and proteasomes and protects against misfolded protein stress.
More...