Property Summary

NCBI Gene PubMed Count 60
PubMed Score 66.92
PubTator Score 52.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
astrocytoma 1493 1.56075032456085E-15
ovarian cancer 8492 1.01641619862892E-9
pilocytic astrocytoma 3086 2.27580120705653E-8
atypical teratoid / rhabdoid tumor 4369 1.09930313538604E-7
pediatric high grade glioma 2712 4.74094888441508E-7
osteosarcoma 7933 1.57246444314241E-6
medulloblastoma, large-cell 6234 2.65786382553962E-6
sonic hedgehog group medulloblastoma 1482 6.65509754667224E-6
glioblastoma 5572 1.45359592373687E-5
invasive ductal carcinoma 2950 8.23078693667312E-4
ductal carcinoma in situ 1745 0.0018871832921203
primitive neuroectodermal tumor 3031 0.00221581895383311
psoriasis 6685 0.00309940212321519
Pick disease 1893 0.00727549173955767
aldosterone-producing adenoma 664 0.0209788044704685
non primary Sjogren syndrome sicca 840 0.0222469232326173
mucosa-associated lymphoid tissue lymphoma 480 0.0236852461319176
subependymal giant cell astrocytoma 2287 0.0288155978014175
ependymoma 2514 0.0498590081291151
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 3.139 1.6
Tracheomalacia 13 3.112 1.6

Expression

Gene

PDB

1KI1   3QBV   2KGR   2KHN   3FIA   4IIM  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (25)

PMID Text
25832561 Study suggests critical roles of ITSN1-S in malignant glioma proliferation, indicating a potential usage of ITSN1-S in the therapeutic intervention as a novel molecular target
25783631 Abnormal expression of the intersectin1-L protein in epileptic brain tissue may play an important role in epilepsy, especially refractory epilepsy.
25496667 Genome-wide shRNA screening identifies ITSN1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24284073 Our observations suggest that ITSN1 is an important general regulator of Cdc42-, Nck- and N-WASP-dependent actin polymerisation
23936226 ITSN1 and ITSN2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
22750298 the neuron-specific isoform of the stable tubule-only polypeptide (STOP) interacts with SH3A domain of ITSN1.
22266851 Silencing ITSN1 significantly inhibits the anchorage independent growth of tumor cells in vitro.
21876463 study reveals a link between overexpression of specific ITSN1 isoforms and behavioral phenotypes
21712076 This novel mammalian ITSN1 isoform possesses a significantly altered domain structure and performs specific protein-protein interactions.
21503949 ITSN1 has two isoforms: ITSN1-long and ITSN1-short. siRNA-mediated down regulation of ITSN1-short inhibits migration and invasion of glioma cells.
More...

AA Sequence

MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNND      1 - 70
GRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVV     71 - 140
GMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVP    141 - 210
PVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFI    211 - 280
LAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTF    281 - 350
EDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE    351 - 420
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKH    421 - 490
QLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSL    491 - 560
HRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERL    561 - 630
KQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQE    631 - 700
AQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVK    701 - 770
GEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS    771 - 840
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQG    841 - 910
EKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMD    911 - 980
SGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVF    981 - 1050
PSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARG   1051 - 1120
KKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDP   1121 - 1190
DWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT   1191 - 1260
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYI   1261 - 1330
RFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENH   1331 - 1400
PDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLY   1401 - 1470
KAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIF   1471 - 1540
HISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKP   1541 - 1610
CRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI   1611 - 1680
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP                                1681 - 1721
//

Text Mined References (72)

PMID Year Title
25832561 2015 Intersectin1-S, a multidomain adapter protein, is essential for malignant glioma proliferation.
25783631 2015 Altered Expression of Intersectin1-L in Patients with Refractory Epilepsy and in Experimental Epileptic Rats.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24284073 2014 Cdc42 and the Rho GEF intersectin-1 collaborate with Nck to promote N-WASP-dependent actin polymerisation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936226 2013 Adaptor proteins intersectin 1 and 2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22750298 2012 Endocytic adaptor protein intersectin 1 forms a complex with microtubule stabilizer STOP in neurons.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
More...