Property Summary

NCBI Gene PubMed Count 60
Grant Count 15
R01 Count 11
Funding $2,070,391.82
PubMed Score 66.92
PubTator Score 52.99

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (25)

PMID Text
25832561 Study suggests critical roles of ITSN1-S in malignant glioma proliferation, indicating a potential usage of ITSN1-S in the therapeutic intervention as a novel molecular target
25783631 Abnormal expression of the intersectin1-L protein in epileptic brain tissue may play an important role in epilepsy, especially refractory epilepsy.
25496667 Genome-wide shRNA screening identifies ITSN1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24284073 Our observations suggest that ITSN1 is an important general regulator of Cdc42-, Nck- and N-WASP-dependent actin polymerisation
23936226 ITSN1 and ITSN2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
22750298 the neuron-specific isoform of the stable tubule-only polypeptide (STOP) interacts with SH3A domain of ITSN1.
22266851 Silencing ITSN1 significantly inhibits the anchorage independent growth of tumor cells in vitro.
21876463 study reveals a link between overexpression of specific ITSN1 isoforms and behavioral phenotypes
21712076 This novel mammalian ITSN1 isoform possesses a significantly altered domain structure and performs specific protein-protein interactions.
21503949 ITSN1 has two isoforms: ITSN1-long and ITSN1-short. siRNA-mediated down regulation of ITSN1-short inhibits migration and invasion of glioma cells.
More...

AA Sequence

MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQIWALADMNND      1 - 70
GRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGIASMPPLTAVAPVPMGSIPVV     71 - 140
GMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASVP    141 - 210
PVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFI    211 - 280
LAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTF    281 - 350
EDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE    351 - 420
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALNDKKH    421 - 490
QLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSL    491 - 560
HRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERL    561 - 630
KQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQE    631 - 700
AQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVK    701 - 770
GEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS    771 - 840
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQG    841 - 910
EKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMD    911 - 980
SGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWWTGTVGDKAGVF    981 - 1050
PSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARG   1051 - 1120
KKRQIGWFPANYVKLLSPGTSKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDP   1121 - 1190
DWWKGEVNGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT   1191 - 1260
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYI   1261 - 1330
RFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENH   1331 - 1400
PDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLY   1401 - 1470
KAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIF   1471 - 1540
HISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKP   1541 - 1610
CRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI   1611 - 1680
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP                                1681 - 1721
//

Text Mined References (72)

PMID Year Title
25832561 2015 Intersectin1-S, a multidomain adapter protein, is essential for malignant glioma proliferation.
25783631 2015 Altered Expression of Intersectin1-L in Patients with Refractory Epilepsy and in Experimental Epileptic Rats.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24284073 2014 Cdc42 and the Rho GEF intersectin-1 collaborate with Nck to promote N-WASP-dependent actin polymerisation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936226 2013 Adaptor proteins intersectin 1 and 2 bind similar proline-rich ligands but are differentially recognized by SH2 domain-containing proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22750298 2012 Endocytic adaptor protein intersectin 1 forms a complex with microtubule stabilizer STOP in neurons.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
More...