Property Summary

NCBI Gene PubMed Count 9
PubMed Score 43.82
PubTator Score 8.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFLFCLPGF      1 - 70
LFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLA     71 - 140
RCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHV    141 - 210
ILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA    211 - 280
YNEKRKKFEKKTE                                                             281 - 293
//

Text Mined References (13)

PMID Year Title