Property Summary

NCBI Gene PubMed Count 191
PubMed Score 6.90
PubTator Score 157.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Protein-protein Interaction (4)

Gene RIF (104)

AA Sequence

MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRS      1 - 70
LDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLV     71 - 140
PRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSS    141 - 210
DPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS                             421 - 465
//

Text Mined References (197)

PMID Year Title