Property Summary

NCBI Gene PubMed Count 179
PubMed Score 5.19
PubTator Score 157.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.64670202967272E-12
group 4 medulloblastoma 1875 1.55977769006428E-6
pediatric high grade glioma 2712 6.26323068711942E-6
cystic fibrosis 1670 6.59531352129656E-6
Duchenne muscular dystrophy 602 1.12617510619342E-5
Amyotrophic Lateral Sclerosis 432 2.56955296874817E-5
ovarian cancer 8492 3.43572611298045E-5
tuberculosis 1563 7.67633825316823E-5
acute quadriplegic myopathy 1157 1.98400201755539E-4
oligodendroglioma 2849 8.00878028338447E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00242489722801768
glioblastoma 5572 0.00415445240648134
ependymoma 2514 0.00462614672690818
psoriasis 6685 0.00500141485545125
astrocytoma 1493 0.00557867240009657
Pick disease 1893 0.00932219125662558
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0118903377223298
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0173136292285439
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0206943144591165
acute myeloid leukemia 785 0.0325455214243864
X-linked cerebral adrenoleukodystrophy 115 0.037573535519035

Expression

Synonym

Accession Q15797 A8KAJ0 D3DNZ9 Q16636 Q9UFT8 MAD homolog 1
Symbols BSP1
JV41
BSP-1
JV4-1
MADH1
MADR1

Gene

PANTHER Protein Class (1)

PDB

2LAZ   2LB0   2LB1   2LAW   2LAX   2LAY   1KHU   3Q47   3Q4A  

  Ortholog (11)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (96)

PMID Text
27049088 The expression SMAD1 protein showed a significant correlation with lung cancer differentiation and lymphatic metastasis (P < 0.05), but not with genders, ages, tumor sizes and histological types of lung cancer patients (P>0.05).
26776318 Regulation of impaired angiogenesis in diabetic dermal wound healing by microRNA-26a is mediated by the increased expression of its target gene, SMAD1.
26227059 Overexpression of Smad1 is associated with prostate cancer.
25880873 adult human Sertoli cells assumed similar morphological features, stable global gene expression profiles and numerous proteins, and activation of AKT and SMAD1/5 during long-period culture.
25761878 Our data indicated that downregulation of miR-26b in osteosarcoma elevated the levels of CTGF and Smad1, facilitating osteosarcoma metastasis
25757624 Smad1 elevation serves as a compensatory mechanism for p53 deficiency by potentiating the activation of p53 parallel pathways.
25639853 SMAD1 signaling may be a key pathway contributing the pathogenesis of Cardio-facio-cutaneous syndrome during early development.
25505291 balance between Smad1/5- and Smad2/3-dependent signaling defines the outcome of the effect of TGF-beta on atherosclerosis where Smad1/5 is responsible for proatherogenic effects
25010525 Smad1 as a novel binding protein of KSHV latency-associated nuclear antigen (LANA). LANA interacted with and sustained BMP-activated p-Smad1 in the nucleus and enhanced its loading on the Id promoters.
24850914 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3.
More...

AA Sequence

MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRS      1 - 70
LDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLV     71 - 140
PRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSS    141 - 210
DPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS                             421 - 465
//

Text Mined References (185)

PMID Year Title
27049088 Expression profiles of SMAD1 protein in lung cancer tissues and normal tissues and its effect on lung cancer incidence.
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26776318 2016 Regulation of impaired angiogenesis in diabetic dermal wound healing by microRNA-26a.
26227059 2016 MiR-345 suppresses proliferation, migration and invasion by targeting Smad1 in human prostate cancer.
25880873 2015 Long-term culture and significant expansion of human Sertoli cells whilst maintaining stable global phenotype and AKT and SMAD1/5 activation.
25761878 2015 MicroRNA-26b inhibits metastasis of osteosarcoma via targeting CTGF and Smad1.
25757624 2015 P53 deficiency-induced Smad1 upregulation suppresses tumorigenesis and causes chemoresistance in colorectal cancers.
25639853 2015 Enhanced SMAD1 Signaling Contributes to Impairments of Early Development in CFC-iPSCs.
25505291 2015 TGF-?1, but not bone morphogenetic proteins, activates Smad1/5 pathway in primary human macrophages and induces expression of proatherogenic genes.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...